Cooking Techniques
PanPotPlates
Cheesy Zucchini and Cauliflower Breakfast Bake
By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 25, 2026 · Updated May 12, 2026
American-Inspired
50 mins
casserolesbreakfasteasyfamily-friendlyvegetarianhealthyglutenfreekid-friendlycomfortfoodmealprep
Start your morning right with this wholesome and easy Cheesy Zucchini and Cauliflower Breakfast Bake. Loaded with fresh zucchini, cauliflower, protein-packed eggs, and melted sharp cheddar cheese, this gluten-free and family-friendly casserole is perfect for make-ahead meals, quick breakfasts, and comforting home cooking.
Prep
15 min
Cook
35 min
Total
50 min
Servings
6
Difficulty
easy
Cuisine
American-Inspired
Ingredients
Servings
6
- 1 medium zucchini, grated
- 2 cups cauliflower florets, finely chopped
- 6 large eggs
- 1 cup shredded sharp cheddar cheese
- 1/2 cup grated Parmesan cheese
- 1/4 cup milk (dairy or plant-based)
- 1 small onion, finely diced
- 2 cloves garlic, minced
- 1 teaspoon dried oregano
- 1/2 teaspoon salt
- 1/4 teaspoon black pepper
- 2 tablespoons olive oil
- Fresh parsley, chopped (optional, for garnish)
Instructions
-
Preheat your oven to 375°F (190°C). Lightly grease a 9x9-inch (or similarly sized) casserole dish with olive oil or cooking spray.
-
Heat olive oil in a large skillet over medium heat. Add diced onion and sauté for 3-4 minutes until translucent.
-
Add minced garlic and cook for an additional 30 seconds until fragrant.
-
Stir in the grated zucchini and chopped cauliflower. Cook for 5-7 minutes, stirring occasionally, until vegetables soften and excess moisture evaporates. Remove from heat.
-
In a large bowl, whisk together eggs, milk, salt, black pepper, and dried oregano until fully combined.
-
Mix in shredded sharp cheddar cheese and grated Parmesan.
-
Fold the sautéed vegetables into the egg and cheese mixture until evenly distributed.
-
Pour the mixture into the prepared casserole dish and spread evenly.
-
Bake for 30-35 minutes until the center is set and the top is lightly golden brown.
-
Allow to cool for 5 minutes before slicing.
-
Garnish with fresh parsley, if desired, and serve warm or at room temperature.
-
Store any leftovers in an airtight container in the refrigerator for up to 4 days and reheat for a nutritious, quick breakfast.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize this casserole to fit your dietary needs or ingredient availability with these easy substitutions:
- Zucchini: Replace with yellow squash or grated carrots for a varied texture and flavor.
- Cauliflower: Use broccoli florets or chopped asparagus as a green vegetable alternative.
- Eggs: For vegan versions, substitute each egg with a flaxseed or chia egg (1 tbsp ground seeds + 3 tbsp water) or use commercial egg replacers compatible with casseroles.
- Sharp Cheddar Cheese: Opt for dairy-free cheese shreds or nutritional yeast for a vegan, dairy-free cheesy taste.
- Parmesan Cheese: Swap with vegan parmesan alternatives or a mix of ground almonds and nutritional yeast for a similar nutty flavor.
- Milk: Choose plant-based milks such as almond, oat, or soy milk to keep the recipe dairy-free or vegan-friendly.
- Olive Oil: Substitute with avocado oil or melted coconut oil if preferred.
These replacements maintain the recipe’s wholesome, gluten-free, and family-friendly qualities without compromising flavor or texture.
Pan Or Pot Required
This recipe falls under the Casseroles category, requiring a casserole dish for baking the mixture to perfection. A standard 9x9-inch or similar-sized ceramic or glass casserole dish is ideal for even heat distribution and easy serving.
For stovetop preparation, a large skillet is essential to sauté the onion, garlic, zucchini, and cauliflower with olive oil. A medium-sized non-stick or stainless steel skillet works perfectly to soften the vegetables while evaporating excess moisture. This streamlined cookware approach complements PanPotPlates’ focus on simple, efficient kitchen tools for quick and family-friendly meal prep.
Cookware Size Guidance
Use a 9x9-inch casserole dish or one closely matching 2 to 2.5 quarts capacity to ensure this Cheesy Zucchini and Cauliflower Breakfast Bake cooks evenly. This size holds the full mixture comfortably without crowding, allowing the center to set while achieving a beautifully golden crust on the edges.
If unavailable, an 8-9 cup round or oval baking dish works well. Avoid overly large shallow dishes which can lead to uneven cooking and underdone centers, or too small deep dishes which extend baking time.
Selecting the right oven-safe glass, ceramic, or metal dish ensures proper portion control and makes reheating leftovers for meal prep simple and effective.
Cookware Swap Guidance
This Cheesy Zucchini and Cauliflower Breakfast Bake is designed for a traditional oven-safe casserole dish, but several substitutions work depending on your kitchen tools and preferences:
- Pie Dish or Deep Baking Dish: Suitable alternatives that allow even baking and easy slicing, matching the family-friendly, easy meal prep style.
- Cast Iron Skillet: An oven-safe cast iron skillet offers excellent heat retention and rustic presentation, ideal for lovers of onepan and comfortfood recipes.
- Sheet Pan with Raised Edges: Using a rimmed sheet pan spreads the casserole thinner, creating crispier edges — a great quick and easy twist on this classic casserole.
- Slow Cooker or Instant Pot Baking Inserts: Adapt this bake for slow cookers or Instant Pots using suitable baking inserts, perfect for hands-off cooking on busy mornings.
Always ensure substitutes are greased well and oven-safe to maintain the dish’s texture and flavor. These options enhance the recipe’s versatility, aligning with varied kitchen setups and the PanPotPlates ethos of easy, family-friendly meals.
Leftovers Quality
This breakfast bake stores exceptionally well, making it ideal for meal prep and busy mornings. Refrigerate leftovers in an airtight container for up to 4 days. For longer storage, freeze individual slices wrapped tightly in plastic wrap and stored in a freezer-safe bag for up to 2 months.
To reheat, thaw frozen portions in the refrigerator overnight, then warm in a microwave covered loosely for 1-2 minutes, or bake in a preheated 350°F (175°C) oven for 10-15 minutes until heated through. Oven reheating preserves the casserole’s texture and maintains a deliciously crisp cheesy top.
Designed for comfort and convenience, this casserole delivers consistent flavor and nutrition even after reheating, ideal for families and meal planners seeking healthy, easy breakfast options.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register