Cooking Techniques
PanPotPlates
International Rustic Vegetable Bake
By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 8, 2026 · Updated May 11, 2026
International
105 mins
slowcookerfreezablehighproteininstantpotonepothealthyfamilyfriendlymealprepvegetariancomfortfood
A hearty, high-protein vegetable casserole perfect for slow cooker or Instant Pot cooking. This rustic bake combines nutrient-packed vegetables and plant-based protein for an easy, flavorful, freezer-friendly meal that’s ideal for batch cooking and family dinners.
Prep
15 min
Cook
90 min
Total
105 min
Servings
6
Difficulty
easy
Cuisine
International
Ingredients
Servings
6
- 1 cup dried lentils, rinsed and drained
- 2 medium carrots, peeled and diced
- 1 red bell pepper, diced
- 1 yellow bell pepper, diced
- 1 small zucchini, diced
- 1 cup green beans, trimmed and cut into 1-inch pieces
- 1 medium onion, chopped
- 3 cloves garlic, minced
- 1 (14 oz) can diced tomatoes with juice
- 2 cups vegetable broth
- 1 tablespoon tomato paste
- 1 teaspoon smoked paprika
- 1 teaspoon ground cumin
- 1/2 teaspoon dried thyme
- 1/2 teaspoon dried oregano
- Salt and black pepper, to taste
- 2 tablespoons olive oil
- 1/4 cup chopped fresh parsley
- 1/2 cup shredded mozzarella or vegan cheese (optional)
Instructions
-
If using Slow Cooker: Heat olive oil in a large skillet over medium heat. Add onion and garlic, sauté for 3-4 minutes until softened.
-
Add bell peppers, carrots, zucchini, and green beans; cook for another 3-4 minutes, stirring occasionally, until vegetables begin to soften.
-
Transfer sautéed vegetables to the slow cooker. Add rinsed lentils, diced tomatoes with juice, tomato paste, vegetable broth, smoked paprika, cumin, thyme, oregano, salt, and pepper. Stir to combine evenly.
-
Cover and cook on low for 6-7 hours or on high for 3-4 hours, until lentils and vegetables are tender and the bake has thickened.
-
If using Instant Pot: Press 'Sauté' and heat olive oil. Add onion and garlic, cooking 3-4 minutes until fragrant. Add bell peppers, carrots, zucchini, and green beans, cooking 3-4 minutes and stirring occasionally.
-
Cancel 'Sauté' mode. Add lentils, diced tomatoes, tomato paste, vegetable broth, and seasonings. Stir well.
-
Lock the lid and set valve to sealing. Cook on 'Pressure Cook' (Manual) high for 15 minutes.
-
When cooking ends, allow natural pressure release for 10 minutes, then carefully release remaining pressure.
-
Open lid and stir. If desired, sprinkle shredded mozzarella or vegan cheese on top and cover until melted.
-
Garnish with fresh parsley before serving.
-
Let cool completely before freezing, or portion into meal prep containers for easy freezer-friendly dinners.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
This recipe offers flexibility to suit dietary needs and seasonal ingredient availability:
- Lentils: Substitute with canned chickpeas, black beans (adjust liquid and cooking times accordingly), or split peas for similar texture. Check packaging to ensure gluten-free options if necessary.
- Vegetables: Replace zucchini or bell peppers with seasonal choices like eggplant, sweet potato, or butternut squash. Frozen mixed vegetables are also convenient and retain flavor.
- Vegetable Broth: Use homemade broth, low-sodium store-bought options, or mushroom broth for an earthy depth. Bouillon cubes are an effective alternative.
- Tomato Products: Fresh tomatoes combined with tomato sauce or puree can replace canned diced tomatoes and tomato paste. Roasted red pepper puree adds a smoky twist.
- Cheese (Optional): For vegan or dairy-free diets, omit cheese or substitute with plant-based alternatives. Nutritional yeast can impart a cheesy flavor without dairy.
- Olive Oil: Avocado oil or other neutral oils are good substitutions, especially for allergies or preferences.
Adjust seasoning after substitutions to maintain a well-balanced flavor profile. These swaps preserve the recipe’s easy, family-friendly, and nutritious qualities.
Pan Or Pot Required
This International Rustic Vegetable Bake is thoughtfully designed for easy, one-pot cooking, suitable for busy families seeking wholesome meals. For the slow cooker approach, start by sautéing onions, garlic, bell peppers, carrots, zucchini, and green beans in a large, heavy-bottomed skillet—such as cast iron or non-stick—to ensure even softening before transferring to the slow cooker.
A slow cooker or crockpot with a minimum capacity of 4 to 6 quarts is recommended to allow ample space for all ingredients and to promote flavor meld during the slow cooking process.
If you choose the Instant Pot, its built-in sauté feature streamlines preparation by cooking the vegetables and lentils in a single pot, reducing cleanup and saving time. Use an Instant Pot or similar electric pressure cooker with sauté function for best results.
Both cooking methods deliver a nutritious, family-friendly casserole with minimal pots and pans, consistent with PanPotPlates’ focus on straightforward, high-protein, and freezer-friendly meal prep. A sturdy wooden spoon or spatula is best for sautéing and stirring.
Cookware Size Guidance
For a recipe serving six people, a slow cooker or Instant Pot with at least 6-quart (5.7-liter) capacity is ideal to accommodate the vegetables, lentils, liquids, and seasonings without overcrowding. This size ensures thorough cooking and safe pressure release for pressure methods.
If baking in the oven, use an 8x8 inch (20x20 cm) or slightly larger casserole dish with around 2 to 3-quart capacity to prevent overcrowding and promote even baking.
Choosing cookware with the correct capacity is essential to achieve optimal texture and flavor, especially as lentils and vegetables expand during cooking.
Cookware Swap Guidance
This rustic vegetable bake is versatile and can be adapted if a slow cooker or Instant Pot isn't available. Consider the following alternative cookware to preserve flavor and texture:
- Oven-Safe Casserole or Dutch Oven: Sauté vegetables on the stovetop in a skillet or Dutch oven, then combine all ingredients and bake covered at 350°F (175°C) until tender. This method closely replicates the casserole style.
- Large Ovenproof Skillet or Deep Sauté Pan: After sautéing, cover tightly and simmer gently on low heat until fully cooked.
- Heavy-Bottomed Pot for Slow Simmering: Use with a lid on very low heat, stirring occasionally to avoid sticking—simulating slow cooker results with more hands-on attention.
- Stovetop Pressure Cooker: Functions similarly to an Instant Pot for pressure cooking; otherwise, rely on slow simmering with longer cook times.
All these options maintain the recipe’s easy, healthy, and freezer-friendly qualities. Even heat distribution and tight covers are crucial for best results.
Leftovers Quality
This International Rustic Vegetable Bake stores well in the refrigerator for up to 4 days when kept in an airtight container, retaining its hearty texture and rich, comforting flavors. The balanced combination of lentils and vegetables makes it ideal for nutritious leftovers and meal prepping.
It freezes exceptionally well for up to 3 months. Be sure to cool completely before transferring to freezer-safe containers or bags. Thaw overnight in the fridge before reheating.
To reheat, microwave portions on medium power, stirring halfway for even heating, or warm covered in a 350°F (175°C) oven for 20-25 minutes. If cheese is included, add it during the last 5 minutes of reheating to melt evenly.
Its freezer-friendly, one-pot nature combined with dynamic international-inspired spices ensures leftovers remain flavorful and convenient for busy weeknights or batch cooking.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register