PanPotPlates

One-Pot Pasta

One-Pot Herb and Garlic Shrimp Risotto

By PanPotPlates Editorial TeamPublished Apr 29, 2026 | Updated May 12, 2026
Mediterranean-Inspired 28 mins onepotquickeasypescatarianfamily-friendlyhealthyglutenfreedairyfreehighproteinweeknightseafoodshrimprisottoMediterranean

A quick and easy Mediterranean-inspired one-pot shrimp risotto bursting with fresh herbs, garlic, and lemon. This healthy, gluten-free, and dairy-free seafood risotto makes a perfect high-protein weeknight pescatarian meal the whole family will love.

One-Pot Herb and Garlic Shrimp Risotto
Prep 10 min
Cook 18 min
Total 28 min
Servings 4
Difficulty easy
Cuisine Mediterranean-Inspired

Recipe Details

Prep10 min
Cook18 min
Total28 min
Servings4
Difficultyeasy
CuisineMediterranean-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1 tablespoon olive oil
  • 4 cloves garlic, minced
  • 1 small onion, finely chopped
  • 1 cup Arborio rice
  • 4 cups low-sodium chicken or vegetable broth (warmed)
  • 1/2 cup dry white wine (optional)
  • 1 pound large shrimp, peeled and deveined
  • 1/2 cup fresh parsley, chopped
  • 2 tablespoons fresh basil, chopped
  • 1 tablespoon fresh lemon juice
  • 1 teaspoon lemon zest
  • Salt and freshly ground black pepper, to taste
  • Red pepper flakes, optional for mild heat
Ingredients for One-Pot Herb and Garlic Shrimp Risotto
Ingredients for One-Pot Herb and Garlic Shrimp Risotto

Instructions

  1. Heat olive oil in a large deep skillet or wide saucepan over medium heat.
  2. Add minced garlic and chopped onion; sauté for 2-3 minutes until fragrant and translucent.
  3. Add Arborio rice and stir to coat the grains with oil, cooking for 1-2 minutes until edges become translucent.
  4. Pour in white wine (if using) and cook, stirring frequently, until mostly absorbed.
  5. Begin adding warm broth one ladle at a time, stirring frequently, allowing liquid to absorb before adding the next ladle.
  6. Continue this process for about 15 minutes until rice is creamy and just tender.
  7. Season shrimp with salt, pepper, and red pepper flakes (if using). Push risotto slightly to the sides and add shrimp to the center of the pan.
  8. Cook shrimp for 2-3 minutes per side until pink and opaque, then gently fold shrimp into the risotto.
  9. Turn off heat and stir in fresh parsley, basil, lemon juice, and lemon zest.
  10. Adjust seasoning with salt and pepper to taste and serve immediately.
One-Pot Herb and Garlic Shrimp Risotto cooking in the recommended pan or pot
One-Pot Herb and Garlic Shrimp Risotto cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe for One-Pot Herb and Garlic Shrimp Risotto excels when prepared in a large deep skillet or wide saucepan .

Cookware Size Guidance

For this One-Pot Herb and Garlic Shrimp Risotto , we recommend a large deep skillet or wide saucepan with a capacity of 3 to 4 quarts (3 to 4 liters).

Cookware Swap Guidance

This recipe, classified under One-Pot Pasta , is designed for quick, easy preparation and minimal cleanup using a large, deep skillet or wide saucepan to ensure even heat and sufficient stirring space.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make One-Pot Herb and Garlic Shrimp Risotto ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this One-Pot Herb and Garlic Shrimp Risotto based on dietary needs or ingredient availability with these substitutions:

  • Shrimp: Substitute scallops or firm white fish for other pescatarian options. For vegetarian versions, use sautéed mushrooms or artichoke hearts.
  • Arborio Rice: Use other short-grain rice varieties or pearl barley (texture will vary slightly).
  • Chicken or Vegetable Broth: Homemade broth or stock cubes are excellent. For vegan versions, use vegetable broth only and replace shrimp with plant-based proteins.
  • Dry White Wine: Optional; replace with extra broth or a splash of lemon juice to maintain acidity if avoiding alcohol.
  • Fresh Herbs (parsley, basil): Swap with cilantro, thyme, or dill according to flavor preference.
  • Olive Oil: Use avocado oil or other mild-flavored oils suitable for sautéing.
  • Garlic and Onion: Shallots or leeks provide milder, sweeter alternatives.

These swaps keep the meal easy, healthy, family-friendly, and ideal for a quick, gluten-free, dairy-free weeknight dinner.

Storage and Reheating

Cool One-Pot Herb and Garlic Shrimp Risotto before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.