PanPotPlates
Back to Recipes

Instant Pot Recipes

Instant Pot Coconut Lime Thai Prawn Curry

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished May 7, 2026 · Updated May 11, 2026
Thai-Inspired 25 mins instantpotquickeasyfamily-friendlyhealthyhighproteinpescatariandairyfreeglutenfreeflavorfultimessavermealpreponepotthai curryprawn currycoconut lime curry

A quick and easy Thai-inspired Instant Pot prawn curry bursting with vibrant coconut lime flavors. This high-protein, gluten-free, and dairy-free curry is perfect for a healthy, family-friendly meal or meal prep. Ready in under 30 minutes, this one-pot recipe delivers bold Thai flavors with tender prawns and fresh vegetables, served over jasmine rice for a complete wholesome dinner.

Instant Pot Coconut Lime Thai Prawn Curry
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine Thai-Inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineThai-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1 tablespoon coconut oil
  • 1 small onion, finely chopped
  • 3 garlic cloves, minced
  • 1 tablespoon fresh ginger, grated
  • 2 tablespoons red Thai curry paste
  • 1 can (14 oz) full-fat coconut milk
  • 1 cup low-sodium chicken or vegetable broth
  • 1 tablespoon fish sauce
  • 1 tablespoon brown sugar
  • Juice and zest of 1 lime
  • 1 pound raw prawns (peeled and deveined)
  • 1 red bell pepper, thinly sliced
  • 1 cup snap peas or green beans, trimmed
  • Fresh cilantro leaves, for garnish
  • Cooked jasmine rice, to serve

Instructions

  1. Set the Instant Pot to 'Sauté' mode and heat the coconut oil until shimmering.
  2. Add the chopped onion and cook, stirring occasionally, until softened, about 3-4 minutes.
  3. Stir in the minced garlic and grated ginger; cook for 1 minute until fragrant.
  4. Add the red Thai curry paste and stir well to combine, cooking for another minute.
  5. Pour in the coconut milk, chicken or vegetable broth, fish sauce, and brown sugar. Stir to mix thoroughly.
  6. Add the lime juice and zest, then stir again.
  7. Cancel the 'Sauté' mode. Secure the lid on the Instant Pot and set the valve to sealing.
  8. Select 'Manual' or 'Pressure Cook' mode and set the timer for 3 minutes.
  9. When cooking is complete, carefully perform a quick pressure release.
  10. Open the lid and stir in the prawns, bell pepper, and snap peas.
  11. Replace the lid and let sit on 'Keep Warm' mode for 5 minutes to cook the prawns through and soften the vegetables.
  12. Open the lid, gently stir to combine, and adjust seasoning with more fish sauce or lime juice if desired.
  13. Serve hot over cooked jasmine rice and garnish with fresh cilantro leaves.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

If you need to modify ingredients in this Instant Pot Coconut Lime Thai Prawn Curry for dietary preferences or ingredient availability, here are some recommended substitutions that retain flavor, nutrition, and simplicity:

  • Prawns: Swap for firm white fish like cod or tilapia for pescatarian options, or cubed firm tofu for a vegan, protein-rich alternative.
  • Fish Sauce: Replace with tamari or coconut aminos to maintain gluten-free and plant-based versions.
  • Coconut Milk: Use almond or cashew milk combined with a tablespoon of coconut extract for a lighter, dairy-free curry.
  • Brown Sugar: Substitute maple syrup or agave nectar for natural, vegan-friendly sweetness.
  • Chicken or Vegetable Broth: Use homemade or store-bought vegetable broth for vegan and budget-friendly options.
  • Red Thai Curry Paste: If unavailable, blend red chili powder, garlic, ginger, lemongrass, and a pinch of cumin to create a fresh curry paste substitute.

These swaps help keep the recipe quick, easy, healthy, and family-friendly while fitting your preferences and maintaining one-pot cooking convenience.

Pan Or Pot Required

This recipe is specially crafted for the Instant Pot, showcasing the convenience of an Instant Pot Recipe. The Instant Pot allows you to sauté, pressure cook, and keep your dish warm—all in one vessel—minimizing cleanup and maximizing flavor retention.

Using the Instant Pot’s multifunctional features ensures quick and even cooking of the sautéed aromatics, rich Thai curry base, and delicate prawns, preserving their vibrant textures and bold flavors. This one-pot method is perfect for busy weeknights, healthy meal prep, and anyone looking for a fast, flavorful, and family-friendly meal.

If you don’t have an Instant Pot, a heavy-bottomed dutch oven or large deep skillet with a lid can be used for sautéing and simmering sequentially; however, this requires more attention and time. For the best one-pot convenience and consistent results, an Instant Pot or a similar electric pressure cooker is highly recommended.

Cookware Size Guidance

For making this Instant Pot Coconut Lime Thai Prawn Curry, a standard 6-quart (6L) Instant Pot is ideal. This size provides enough room to sauté aromatics, build the curry, and accommodate the prawns and vegetables evenly without overcrowding, helping maintain vibrant flavors and consistent cooking.

A 6-quart Instant Pot comfortably yields 4 servings, matching the recipe perfectly. Smaller 3-quart units can cook this recipe if halved to prevent spillage and ensure proper pressure build-up. Larger 8-quart or bigger models may offer more space but may require adjustments in cooking times or ingredient quantity for best results.

Stick with an Instant Pot or comparable electric pressure cooker size to enjoy the quick, easy, and healthy one-pot benefits of this vibrant Thai prawn curry.

Cookware Swap Guidance

This flavorful Thai prawn curry is optimized for the Instant Pot’s fast pressure cooking. If you don’t own one, here are alternative cookware options to still enjoy this vibrant one-pot meal:

  • Slow Cooker: Brown onions, garlic, and curry paste in a skillet before transferring to a slow cooker. Cook on low for 3-4 hours, adding prawns and vegetables in the last 30 minutes to avoid overcooking.
  • Dutch Oven or Large Pot: Sauté aromatics and curry paste on the stovetop. Add liquids and simmer gently for 10-15 minutes. Stir in prawns and vegetables, cooking until just tender.
  • Deep Skillet or Sauté Pan with Lid: Use a deep skillet covered with a lid to sauté and simmer, trapping steam to mimic pressure cooking environment.

Adjust cooking times and monitor closely when swapping cookware to preserve the dish’s gluten-free, dairy-free, and protein-rich qualities. These options enable you to enjoy a quick, family-friendly Thai curry meal even without specialized electric appliances.

Leftovers Quality

This Instant Pot Coconut Lime Thai Prawn Curry makes delicious leftovers, ideal for quick meals throughout the week. Store any uneaten curry in an airtight container in the refrigerator within two hours after cooking. For best quality and safety, consume refrigerated leftovers within 2 days since seafood and coconut milk are most fresh when freshly cooked.

Reheat gently on the stovetop over medium-low heat or in short microwave intervals, stirring frequently. Add a splash of water or broth if the sauce thickens. Avoid overheating to keep prawns tender and preserve the fresh lime and curry flavors.

This one-pot, high-protein, gluten-free, and dairy-free dish also freezes well for up to 1 month. Cool completely before freezing in a sealed container. Thaw overnight in the refrigerator and reheat gently as described.

Enjoy this easy, family-friendly, and flavorful Thai curry again with minimal fuss, perfect for meal prep and busy lifestyles.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.