PanPotPlates
Back to Recipes

Instant Pot Recipes

Instant Pot Spicy Korean Beef and Vegetable Bibimbap

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 15, 2026 · Updated May 11, 2026
Korean-Inspired 40 mins instantpotonepotquickeasyfamily-friendlyhealthyhighproteinflavorfulmealprepweeknightlowcarb

Make this delicious and nutritious Korean bibimbap in your Instant Pot for a fast and easy one-pot meal. Spicy marinated beef, sautéed vegetables, and fluffy rice come together in a family-friendly, high-protein dish perfect for weeknight dinners and meal prep.

Instant Pot Spicy Korean Beef and Vegetable Bibimbap
Prep 15 min
Cook 25 min
Total 40 min
Servings 4
Difficulty easy
Cuisine Korean-Inspired

Recipe Details

Prep15 min
Cook25 min
Total40 min
Servings4
Difficultyeasy
CuisineKorean-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1 1/2 cups jasmine or short-grain rice, rinsed and drained
  • 1 3/4 cups water or low-sodium beef broth
  • 1 lb lean ground beef
  • 2 tablespoons gochujang (Korean red chili paste)
  • 1 tablespoon soy sauce
  • 1 tablespoon sesame oil, divided
  • 1 tablespoon brown sugar
  • 3 cloves garlic, minced
  • 1 teaspoon grated fresh ginger
  • 1 small zucchini, julienned
  • 1 medium carrot, julienned
  • 1 cup shiitake mushrooms, sliced
  • 2 cups fresh spinach
  • 2 green onions, thinly sliced
  • 2 large eggs
  • 1 tablespoon vegetable oil
  • 1 tablespoon toasted sesame seeds
  • Salt and pepper, to taste

Instructions

  1. Set the Instant Pot to 'Sauté' mode and add 1 tablespoon sesame oil and vegetable oil.
  2. Once oil is hot, add minced garlic and grated fresh ginger; sauté for 30 seconds until fragrant.
  3. Add lean ground beef, season with salt and pepper, and cook until browned, breaking up the meat with a spoon, about 5 minutes.
  4. Stir in gochujang, soy sauce, and brown sugar, mixing thoroughly to coat the beef evenly. Cook for an additional 1-2 minutes to blend flavors.
  5. Push the beef mixture to one side of the Instant Pot. Add zucchini, carrot, and shiitake mushrooms to the other side and sauté for 3-4 minutes until slightly tender.
  6. Evenly spread the rinsed rice over the beef and vegetables. Pour water or beef broth over the rice without stirring.
  7. Close the lid, set the valve to sealing, and cook on 'Pressure Cook' (Manual) at high pressure for 6 minutes.
  8. Allow a natural pressure release for 10 minutes, then carefully perform a quick release to release any remaining pressure.
  9. Open the lid and top with fresh spinach and sliced green onions. Close the lid and let it sit on 'Keep Warm' mode for 2 minutes to wilt the spinach.
  10. In a separate skillet, heat a small amount of oil over medium heat and fry eggs sunny side up or to preferred doneness.
  11. Gently fluff the rice and vegetable mixture with a fork to slightly combine the layers.
  12. Divide the bibimbap into serving bowls, top each with a fried egg, and sprinkle with toasted sesame seeds before serving.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize your Instant Pot Korean Beef and Vegetable Bibimbap to fit dietary needs, preferences, or ingredient availability with these easy substitutions:

  • Ground Beef: Substitute with ground turkey, chicken, or plant-based crumbles to reduce fat or accommodate vegetarian diets (replace eggs accordingly for vegan options).
  • Gochujang: Replace with chili garlic sauce mixed with miso paste to achieve a similar spicy-sweet depth if unavailable.
  • Soy Sauce: Use tamari or coconut aminos for gluten-free and soy-free versions.
  • Rice: Swap jasmine or short-grain rice with brown rice for more fiber or cauliflower rice for a low-carb, keto-friendly alternative (adjust cooking times accordingly).
  • Eggs: Omit for vegan meals or replace with sautéed mushrooms, tofu scramble, or avocado slices for richness.
  • Vegetables: Feel free to substitute zucchini, carrot, or shiitake mushrooms with seasonal vegetables like bell peppers, snap peas, or bok choy for variety.
  • Sesame Oil: Use toasted walnut or avocado oil if allergies are a concern.

These replacements ensure your bibimbap stays nutritious, flavorful, and perfect for a family-friendly, easy weekday dinner.

Pan Or Pot Required

This recipe is crafted specifically for the Instant Pot, an indispensable multi-functional electric pressure cooker that delivers a flavorful and tender Korean-inspired bibimbap all in one pot. The Instant Pot simplifies cooking by enabling you to sauté aromatics, brown beef, cook vegetables, and pressure-cook rice and ingredients together, minimizing cleanup.

By using the Instant Pot as both a sauté pan and pressure cooker pot, you not only save time but also enhance flavor melding for a delicious, evenly cooked meal. For topping, a quick fry of eggs in a separate skillet ensures perfect sunny-side-up eggs complementing the bibimbap.

Essentials:

  • Instant Pot or similar electric pressure cooker: Required to complete this one-pot recipe with pressure cooking and sauté functions.
  • Separate skillet or frying pan: Needed only to fry eggs to desired doneness for topping.

This cookware combination suits busy families and meal preppers seeking a healthy, high-protein, and flavorful dinner with minimal mess.

Cookware Size Guidance

For the Instant Pot Spicy Korean Beef and Vegetable Bibimbap, a 6-quart Instant Pot is ideal. This size balances ample space for sautéing beef and vegetables, cooking rice, and proper pressure buildup without overcrowding.

If you have a smaller Instant Pot (3-4 quarts), it's recommended to halve the ingredient quantities to avoid overfilling and uneven cooking. Larger models (8 quarts or more) are compatible but may require slight adjustments in liquids and cooking time.

When using other electric pressure cookers, ensure a minimum 4-quart capacity for safe and effective cooking.

Choosing the right-sized Instant Pot maximizes cooking efficiency and cleanup ease, reinforcing this dish's appeal for weeknight meals and meal prep.

Cookware Swap Guidance

This Instant Pot Spicy Korean Beef and Vegetable Bibimbap shines as a quick, easy one-pot meal perfect for Instant Pot cooking. However, if you don't own an Instant Pot, here are alternative cookware options that maintain convenience and flavor:

  • Stovetop Dutch Oven or Heavy-Bottomed Pot: Brown the beef and sauté vegetables over medium heat. Add rice and broth, then cover tightly and simmer gently for about 20 minutes until rice is cooked. This replicates the one-pot concept while keeping flavors well layered.
  • Slow Cooker: Brown and sauté ingredients separately, then combine in the slow cooker with rice and broth. Cook on high for 2-3 hours or low for 4-5 hours. Rice texture may vary, but the dish remains hearty and flavorful.
  • Large Skillet with Lid: Use your largest skillet with a lid to sauté ingredients and then steam rice by covering. Stir occasionally and monitor rice to prevent sticking, suitable for quick and simple meals.

Note: While these alternatives deliver tasty results, the Instant Pot’s pressure cooking method provides unique tenderness and significantly reduces cooking time. For authentic flavor and convenience, the Instant Pot is preferred when available.

Leftovers Quality

This Instant Pot Spicy Korean Beef and Vegetable Bibimbap is an excellent meal prep and leftover-friendly recipe that maintains flavor and nutrition for several days.

Storage Recommendations: Store leftovers in airtight containers in the refrigerator for up to 3-4 days. To preserve texture, keep the fried eggs separate if possible. This dish also freezes well; portion into freezer-safe containers and freeze up to 2 months.

Reheating Tips: Microwave leftovers on medium power to prevent dryness, stirring halfway for even heating. Alternatively, reheat in a skillet with a bit of sesame or vegetable oil to refresh flavors and texture. For frozen portions, thaw overnight in the fridge prior to reheating.

With its quick preparation and lasting appeal, this bibimbap is perfect for busy households seeking nutritious, high-protein meals on the go.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.