PanPotPlates

One-Pot Comfort Food

Instant Pot Low-Carb Pescatarian Stuffed Peppers

By PanPotPlates Editorial TeamPublished Apr 20, 2026 | Updated May 11, 2026
Mediterranean-Inspired 35 mins instantpotonepotpescatarianhealthylowcarbquickeasyfamily-friendlyweeknightflavorfulmealprepcomfortfood

Enjoy this healthy and quick Instant Pot recipe featuring Mediterranean-style low-carb stuffed peppers filled with shrimp, zucchini, feta, and fresh herbs. Ready in under 40 minutes, this one-pot meal offers a nutritious, protein-rich seafood dinner that’s family-friendly and flavorful.

Instant Pot Low-Carb Pescatarian Stuffed Peppers
Prep 15 min
Cook 20 min
Total 35 min
Servings 4
Difficulty easy
Cuisine Mediterranean-Inspired

Recipe Details

Prep15 min
Cook20 min
Total35 min
Servings4
Difficultyeasy
CuisineMediterranean-Inspired
Add To Favorites

Ingredients

Servings 4
  • 4 large bell peppers (any color), tops cut off and seeds removed
  • 1 lb raw shrimp, peeled and deveined, chopped roughly
  • 1 medium zucchini, finely diced
  • 1 small red onion, finely chopped
  • 2 cloves garlic, minced
  • 1 cup crumbled feta cheese
  • 1/4 cup chopped fresh parsley
  • 1/4 cup chopped fresh dill
  • 1 tbsp olive oil
  • 1 tsp smoked paprika
  • 1/2 tsp dried oregano
  • Salt and freshly ground black pepper, to taste
  • 1/2 cup low-sodium vegetable broth
  • 2 tbsp lemon juice
  • Red pepper flakes (optional, for mild heat)
Ingredients for Instant Pot Low-Carb Pescatarian Stuffed Peppers
Ingredients for Instant Pot Low-Carb Pescatarian Stuffed Peppers

Instructions

  1. Set the Instant Pot to 'Sauté' mode and heat olive oil. Add chopped red onion and minced garlic, cooking until translucent and fragrant, about 3 minutes.
  2. Add diced zucchini, smoked paprika, dried oregano, salt, and pepper. Sauté for an additional 3 minutes, stirring occasionally until zucchini is slightly softened.
  3. Turn off 'Sauté' mode and transfer the cooked vegetables to a bowl to cool slightly.
  4. In the same bowl, mix the sautéed vegetable mixture with chopped shrimp, crumbled feta cheese, fresh parsley, dill, lemon juice, and red pepper flakes if desired. Stir well until combined evenly.
  5. Generously stuff each hollowed bell pepper with the shrimp and vegetable filling, pressing down gently to fill completely.
  6. Pour 1/2 cup low-sodium vegetable broth into the Instant Pot’s inner pot. Place the stuffed peppers upright on the included steamer rack or trivet inside the pot.
  7. Secure the Instant Pot lid, set the valve to 'Sealing,' and cook on 'Manual' or 'Pressure Cook' at high pressure for 8 minutes.
  8. When cook time ends, allow a natural pressure release for 5 minutes, then carefully perform a quick release for any remaining pressure.
  9. Remove the stuffed peppers carefully from the pot. Spoon any cooking liquid over the peppers for added moisture and flavor.
  10. Serve the stuffed peppers warm, garnished with extra fresh parsley or a squeeze of lemon if desired.
Instant Pot Low-Carb Pescatarian Stuffed Peppers cooking in the recommended pan or pot
Instant Pot Low-Carb Pescatarian Stuffed Peppers cooking in the recommended pan or pot

Tips

Pan Or Pot Required

For this One-Pot Comfort Food recipe, the Instant Pot is essential cookware.

Cookware Size Guidance

For best results with this One-Pot Comfort Food recipe, use a 6-quart Instant Pot or similar electric pressure cooker model.

Cookware Swap Guidance

This recipe is optimized for the Instant Pot , leveraging the pressure cooker’s speed and moisture retention to create tender, flavorful stuffed bell peppers in under 40 minutes.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Instant Pot Low-Carb Pescatarian Stuffed Peppers ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a Instant Pot or electric pressure cooker and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this Instant Pot Low-Carb Pescatarian Stuffed Peppers recipe to your dietary preferences or pantry with these ingredient substitutions that keep it quick, healthy, and delicious:

  • Shrimp: Replace with cooked scallops, firm white fish chunks, or canned tuna as alternate pescatarian proteins.
  • Feta Cheese: Use dairy-free feta or omit for dairy-free diets. For vegan variations, try marinated tofu cubes.
  • Zucchini: Swap with finely diced eggplant or summer squash for seasonal variety.
  • Bell Peppers: Use large portobello mushroom caps or hollowed tomatoes as a unique vessel alternative compatible with Instant Pot cooking.
  • Vegetable Broth: Substitute low-sodium chicken broth or seafood stock to deepen flavor while keeping the meal low carb.
  • Olive Oil: Exchange with avocado oil or melted coconut oil for different healthy fat sources.
  • Fresh Herbs (Parsley & Dill): Try basil or cilantro for a fresh, complementary seafood flavor twist.
  • Spices: Add cumin or coriander for warm, aromatic notes or omit smoked paprika for a milder taste.

All swaps retain the recipe’s family-friendly, healthy, low-carb, instantpot, onepot, and flavorful

Storage and Reheating

Cool Instant Pot Low-Carb Pescatarian Stuffed Peppers before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.