What cookware works best?

Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.

How do I know it is done?

Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.

Can I adjust the seasoning?

Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Back to Recipes

One-Pot Vegan

Low-Carb Pescatarian Cauliflower Rice Sushi Bowls

Name: Low-Carb Pescatarian Cauliflower Rice Sushi Bowls
Prep time: 15 min
Cook time: 10 min
Total time: 25 min
Yield: 4 servings
Cuisine: Japanese-Inspired
Ingredients: 1 large head cauliflower, riced (or 4 cups bagged cauliflower rice); 1 tablespoon toasted sesame oil; 2 teaspoons rice vinegar; 1 tablespoon low-sodium tamari or soy sauce (gluten-free if needed); 1 teaspoon grated fresh ginger; 1 teaspoon maple syrup or agave nectar; 1 cup shelled edamame, cooked; 1 medium cucumber, diced; 1 cup shredded carrots; 1 ripe avocado, sliced; 4 ounces smoked or cooked wild-caught salmon, flaked (omit for strict vegan); 2 sheets nori, thinly sliced; 2 tablespoons toasted sesame seeds; 2 scallions, thinly sliced; Pickled ginger, for serving (optional); Wasabi paste, for serving (optional)

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished May 4, 2026

Japanese-Inspired 25 mins lowcarbpescatarianveganglutenfreedairyfreeeasyquickhealthyfamily-friendlymealprep

Low-Carb Pescatarian Cauliflower Rice Sushi Bowls is a practical PanPotPlates recipe built for dependable weeknight cooking.

Prep 15 min

Cook 10 min

Total 25 min

Servings 4

Difficulty easy

Cuisine Japanese-Inspired

Ingredients

Servings 4

1 large head cauliflower, riced (or 4 cups bagged cauliflower rice)
1 tablespoon toasted sesame oil
2 teaspoons rice vinegar
1 tablespoon low-sodium tamari or soy sauce (gluten-free if needed)
1 teaspoon grated fresh ginger
1 teaspoon maple syrup or agave nectar
1 cup shelled edamame, cooked
1 medium cucumber, diced
1 cup shredded carrots
1 ripe avocado, sliced
4 ounces smoked or cooked wild-caught salmon, flaked (omit for strict vegan)
2 sheets nori, thinly sliced
2 tablespoons toasted sesame seeds
2 scallions, thinly sliced
Pickled ginger, for serving (optional)
Wasabi paste, for serving (optional)

Ingredients for Low-Carb Pescatarian Cauliflower Rice Sushi Bowls

Instructions

Prepare the cauliflower rice by pulsing cauliflower florets in a food processor until rice-sized. Alternatively, use pre-riced cauliflower from the store.
Heat the toasted sesame oil in a large nonstick skillet over medium heat. Add the grated fresh ginger and sauté for 1 minute until fragrant.
Add the cauliflower rice to the skillet and stir well to combine with the ginger and oil. Cook for 5 minutes, stirring occasionally, until slightly tender but not mushy.
In a small bowl, mix together rice vinegar, tamari, and maple syrup. Drizzle over the cauliflower rice and stir well to coat. Cook for another 2 minutes, then remove from heat.
Divide the cauliflower rice evenly among serving bowls.
Top each bowl with cooked edamame, diced cucumber, shredded carrots, sliced avocado, and the flaked salmon (if using).
Sprinkle sliced nori, toasted sesame seeds, and scallions evenly over each bowl.
Serve immediately with optional pickled ginger and wasabi paste for an authentic sushi flavor experience.
For meal prep, cover bowls tightly and refrigerate for up to 3 days. Keep avocado slices fresh by adding them close to serving time to prevent browning.

Low-Carb Pescatarian Cauliflower Rice Sushi Bowls cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is ideally prepared in a large nonstick skillet , perfectly fitting its classification as a One-Pot Vegan meal.

Cookware Size Guidance

For preparing this One-Pot Vegan cauliflower rice sushi bowl serving 4 people, select a large nonstick skillet or sauté pan between 10 to 12 inches in diameter.

Cookware Swap Guidance

This recipe is crafted as a one-pot vegan skillet meal that’s quick, healthy, easy, and family-friendly .

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Low-Carb Pescatarian Cauliflower Rice Sushi Bowls ahead?: Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?: Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.
How do I know it is done?: Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?: Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

This flexible sushi bowl recipe lends itself to several ingredient swaps to match dietary preferences and ingredient availability:

Cauliflower Rice: Substitute with finely chopped broccoli or shaved zucchini for a similar low-carb base.
Smoked or Cooked Salmon: Omit for a fully vegan version; replace with marinated baked tofu or grilled tempeh to boost protein and texture.
Low-Sodium Tamari or Soy Sauce: Use coconut aminos as a gluten-free, soy-free, umami-rich alternative.
Maple Syrup or Agave Nectar: Brown rice syrup or date syrup are great vegan-friendly sweetener options.
Edamame: Replace with shelled peas or cooked chickpeas to vary texture and add plant-based protein.
Nori Sheets: Toasted seaweed flakes can substitute if nori is unavailable, or omit for a simplified bowl.

These ingredient swaps keep the meal aligned with the goals of a quick, easy, healthy, low-carb, pescatarian, vegan, gluten-free, and family-friendly one-pot vegan dinner.

Storage and Reheating

Cool Low-Carb Pescatarian Cauliflower Rice Sushi Bowls before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Low-Carb Pescatarian Cauliflower Rice Sushi Bowls

Recipe Details

Ingredients

Instructions