What cookware works best?

Use a pan or pot named in the recipe and avoid crowding so the recipe cooks evenly.

How do I know it is done?

Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.

Can I adjust the seasoning?

Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Back to Recipes

One-Pan Chicken

One-Pan Balsamic Glazed Turkey Meatballs with Green Beans

Name: One-Pan Balsamic Glazed Turkey Meatballs with Green Beans
Prep time: 15 min
Cook time: 20 min
Total time: 35 min
Yield: 4 servings
Cuisine: American
Ingredients: 1 lb ground turkey; 1/4 cup grated Parmesan cheese; 1/4 cup panko breadcrumbs; 1 large egg; 2 cloves garlic, minced; 1 teaspoon dried Italian seasoning; 1/2 teaspoon salt; 1/4 teaspoon black pepper; 1 tablespoon olive oil; 12 oz fresh green beans, trimmed; 1/3 cup balsamic vinegar; 1 tablespoon honey; 1/2 teaspoon red pepper flakes (optional)

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 8, 2026 · Updated May 11, 2026

American 35 mins onepaneasyfamily-friendlykid-friendlyhealthylowcarblightleftoversbudget-friendlyweeknightfamilydinner

Easy one-pan balsamic glazed turkey meatballs with green beans — a healthy, low-carb family dinner that’s quick, flavorful, and budget-friendly. Perfect for busy weeknights with tender meatballs coated in a tangy balsamic glaze alongside crisp green beans.

Prep 15 min

Cook 20 min

Total 35 min

Servings 4

Difficulty easy

Cuisine American

Ingredients

Servings 4

1 lb ground turkey
1/4 cup grated Parmesan cheese
1/4 cup panko breadcrumbs
1 large egg
2 cloves garlic, minced
1 teaspoon dried Italian seasoning
1/2 teaspoon salt
1/4 teaspoon black pepper
1 tablespoon olive oil
12 oz fresh green beans, trimmed
1/3 cup balsamic vinegar
1 tablespoon honey
1/2 teaspoon red pepper flakes (optional)

Ingredients for One-Pan Balsamic Glazed Turkey Meatballs with Green Beans

Instructions

In a large bowl, combine ground turkey, Parmesan cheese, panko breadcrumbs, egg, garlic, Italian seasoning, salt, and black pepper. Mix gently until just combined, avoiding overmixing to keep meatballs tender.
Form the mixture into 16 small meatballs, about 1 to 1.5 inches in diameter.
Heat olive oil in a large nonstick skillet over medium heat.
Add turkey meatballs in a single layer and cook for 6-8 minutes, turning occasionally, until evenly browned and cooked through. Remove meatballs from skillet and set aside.
Add trimmed green beans to the same skillet and sauté for 4-5 minutes until crisp-tender.
In a small bowl, whisk together balsamic vinegar, honey, and red pepper flakes (if using).
Return meatballs to the skillet with green beans and pour the balsamic glaze evenly over the top.
Cook and gently stir for 2-3 minutes until glaze thickens slightly and coats meatballs and green beans evenly.
Remove from heat and serve immediately. Optionally, garnish with extra Parmesan cheese or fresh parsley.

One-Pan Balsamic Glazed Turkey Meatballs with Green Beans cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is a true one-pan meal , ideal for busy families seeking a fast, healthy, and hassle-free dinner.

Cookware Size Guidance

For best results, use a large nonstick skillet or sauté pan about 10 to 12 inches in diameter .

Cookware Swap Guidance

A large nonstick skillet is preferred for this one-pan balsamic glazed turkey meatballs recipe due to easy searing and cleanup.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make One-Pan Balsamic Glazed Turkey Meatballs with Green Beans ahead?: Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?: Use a pan or pot named in the recipe and avoid crowding so the recipe cooks evenly.
How do I know it is done?: Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?: Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize One-Pan Balsamic Glazed Turkey Meatballs with Green Beans based on your preferences or dietary needs:

Ground Turkey: Substitute with ground chicken or lean ground beef to vary protein while keeping it low-carb and healthy.
Parmesan Cheese: Swap for nutritional yeast for a dairy-free, vegan-friendly umami kick.
Panko Breadcrumbs: Use crushed gluten-free crackers or almond flour to make this recipe gluten-free.
Honey: Replace with maple syrup or agave nectar for a vegan sweetener alternative.
Green Beans: Try asparagus tips, snap peas, or broccoli florets for seasonal variation and different textures.
Red Pepper Flakes: Skip for a mild flavor or replace with smoked paprika for subtle smoky warmth without heat.

These swaps preserve the recipe’s simplicity, family-friendliness, and nutritional benefits.

Storage and Reheating

Cool One-Pan Balsamic Glazed Turkey Meatballs with Green Beans before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

One-Pan Balsamic Glazed Turkey Meatballs with Green Beans

Recipe Details

Ingredients

Instructions