PanPotPlates

One-Pan Chicken

One-Pan Balsamic Glazed Turkey Meatballs with Green Beans

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 8, 2026 · Updated May 11, 2026
American 35 mins onepaneasyfamily-friendlykid-friendlyhealthylowcarblightleftoversbudget-friendlyweeknightfamilydinner

Easy one-pan balsamic glazed turkey meatballs with green beans — a healthy, low-carb family dinner that’s quick, flavorful, and budget-friendly. Perfect for busy weeknights with tender meatballs coated in a tangy balsamic glaze alongside crisp green beans.

One-Pan Balsamic Glazed Turkey Meatballs with Green Beans
Prep 15 min
Cook 20 min
Total 35 min
Servings 4
Difficulty easy
Cuisine American

Recipe Details

Prep15 min
Cook20 min
Total35 min
Servings4
Difficultyeasy
CuisineAmerican
Add To Favorites

Ingredients

Servings 4
  • 1 lb ground turkey
  • 1/4 cup grated Parmesan cheese
  • 1/4 cup panko breadcrumbs
  • 1 large egg
  • 2 cloves garlic, minced
  • 1 teaspoon dried Italian seasoning
  • 1/2 teaspoon salt
  • 1/4 teaspoon black pepper
  • 1 tablespoon olive oil
  • 12 oz fresh green beans, trimmed
  • 1/3 cup balsamic vinegar
  • 1 tablespoon honey
  • 1/2 teaspoon red pepper flakes (optional)

Instructions

  1. In a large bowl, combine ground turkey, Parmesan cheese, panko breadcrumbs, egg, garlic, Italian seasoning, salt, and black pepper. Mix gently until just combined, avoiding overmixing to keep meatballs tender.
  2. Form the mixture into 16 small meatballs, about 1 to 1.5 inches in diameter.
  3. Heat olive oil in a large nonstick skillet over medium heat.
  4. Add turkey meatballs in a single layer and cook for 6-8 minutes, turning occasionally, until evenly browned and cooked through. Remove meatballs from skillet and set aside.
  5. Add trimmed green beans to the same skillet and sauté for 4-5 minutes until crisp-tender.
  6. In a small bowl, whisk together balsamic vinegar, honey, and red pepper flakes (if using).
  7. Return meatballs to the skillet with green beans and pour the balsamic glaze evenly over the top.
  8. Cook and gently stir for 2-3 minutes until glaze thickens slightly and coats meatballs and green beans evenly.
  9. Remove from heat and serve immediately. Optionally, garnish with extra Parmesan cheese or fresh parsley.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize One-Pan Balsamic Glazed Turkey Meatballs with Green Beans based on your preferences or dietary needs:

  • Ground Turkey: Substitute with ground chicken or lean ground beef to vary protein while keeping it low-carb and healthy.
  • Parmesan Cheese: Swap for nutritional yeast for a dairy-free, vegan-friendly umami kick.
  • Panko Breadcrumbs: Use crushed gluten-free crackers or almond flour to make this recipe gluten-free.
  • Honey: Replace with maple syrup or agave nectar for a vegan sweetener alternative.
  • Green Beans: Try asparagus tips, snap peas, or broccoli florets for seasonal variation and different textures.
  • Red Pepper Flakes: Skip for a mild flavor or replace with smoked paprika for subtle smoky warmth without heat.

These swaps preserve the recipe’s simplicity, family-friendliness, and nutritional benefits.

Pan Or Pot Required

This recipe is a true one-pan meal, ideal for busy families seeking a fast, healthy, and hassle-free dinner. Use a large nonstick skillet or a heavy-bottomed frying pan to brown 16 turkey meatballs evenly while sautéing fresh green beans alongside.

A 10-12 inch skillet provides enough space to ensure proper browning and caramelization of the meatballs without overcrowding, enhancing flavor and texture. The same pan is used to cook the green beans and simmer the balsamic glaze, melding all flavors in one easy dish.

Minimizing dishes makes cleanup quick, supporting a stress-free weeknight routine while delivering a nutritious, low-carb, kid-friendly meal.

Cookware Size Guidance

For best results, use a large nonstick skillet or sauté pan about 10 to 12 inches in diameter. This size comfortably browns 16 turkey meatballs in a single layer and simultaneously sautés 12 ounces of green beans.

Choosing the right pan size prevents steaming meatballs from crowding or uneven cooking due to overly sparse ingredients. It also ensures the balsamic glaze coats all components evenly.

Optional use of a lid can speed cooking and soften green beans quicker, but is not necessary. Preheating the pan to medium heat facilitates even searing and optimal caramelization for a delicious, family-friendly one-pan dinner.

Cookware Swap Guidance

A large nonstick skillet is preferred for this one-pan balsamic glazed turkey meatballs recipe due to easy searing and cleanup. If unavailable, a well-seasoned cast iron skillet is an excellent alternative, offering superior heat retention; just add a bit more oil to prevent sticking.

High-sided enameled sauté pans also work well, providing room for tossing meatballs and green beans with the glaze. Avoid pans with low sides that may cause spills during stirring.

For slow cooking enthusiasts, transfer browned meatballs and green beans with glaze to a slow cooker and cook on low for 2-3 hours to deepen flavor, shifting the recipe toward a Slow Cooker One-Pot version rather than stovetop quick-cooking.

Instant Pot users can brown meatballs using the sauté function, then add green beans and glaze and finish with a brief low-pressure cook—preserving the dish’s onepan, easy, and family-friendly qualities.

Choose cookware that supports both searing and gentle simmering to optimize flavor development while minimizing cleanup, aligning with the One-Pan Chicken style of this healthy, low-carb meal.

Leftovers Quality

Leftover one-pan balsamic glazed turkey meatballs with green beans keep well for 3-4 days refrigerated in an airtight container. To preserve flavor and moisture, reheat gently in a skillet over medium-low heat, stirring occasionally to maintain the balsamic glaze’s richness.

Microwaving on medium power in short bursts covered with a microwave-safe lid or wrap also works, preventing drying.

This dish freezes well for up to 2 months when stored in freezer-safe containers or bags. Thaw overnight in the refrigerator before reheating.

Leftovers offer a convenient, nutritious option for quick lunches or dinners while retaining the dish’s fresh taste and wholesome appeal.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.