Can I make One-Pan Spiced Chickpea and Sweet Potato Hash ahead?

Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.

What cookware works best?

Use a pan or pot named in the recipe and avoid crowding so the recipe cooks evenly.

How do I know it is done?

Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.

Can I adjust the seasoning?

Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Back to Recipes

One-Pan Chicken

One-Pan Spiced Chickpea and Sweet Potato Hash

Name: One-Pan Spiced Chickpea and Sweet Potato Hash
Prep time: 10 min
Cook time: 20 min
Total time: 30 min
Yield: 4 servings
Cuisine: Middle Eastern-Inspired
Ingredients: 1 tablespoon olive oil; 1 large sweet potato, peeled and diced into ½-inch cubes; 1 small red onion, diced; 3 garlic cloves, minced; 1 (15-ounce) can chickpeas, drained and rinsed; 1 red bell pepper, diced; 1 teaspoon ground cumin; 1 teaspoon smoked paprika; ½ teaspoon ground coriander; ¼ teaspoon cayenne pepper (optional, adjust to taste); Salt and freshly ground black pepper, to taste; ½ cup vegetable broth or water; 2 tablespoons fresh parsley, chopped; Juice of ½ lemon

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 13, 2026 · Updated May 11, 2026

Middle Eastern-Inspired 30 mins onepanone-paneasyquickhealthyvegetarianglutenfreedairyfreefamily-friendlyweeknightlowcarbflavorfulmeatless

A quick and healthy Middle Eastern-inspired chickpea and sweet potato hash cooked entirely in one skillet. This easy, gluten-free, dairy-free, and vegetarian recipe is bursting with flavorful spices, perfect for busy weeknight dinners and wholesome family meals.

One-Pan Spiced Chickpea and Sweet Potato Hash

Prep 10 min

Cook 20 min

Total 30 min

Servings 4

Difficulty easy

Cuisine Middle Eastern-Inspired

Ingredients

Servings 4

1 tablespoon olive oil
1 large sweet potato, peeled and diced into ½-inch cubes
1 small red onion, diced
3 garlic cloves, minced
1 (15-ounce) can chickpeas, drained and rinsed
1 red bell pepper, diced
1 teaspoon ground cumin
1 teaspoon smoked paprika
½ teaspoon ground coriander
¼ teaspoon cayenne pepper (optional, adjust to taste)
Salt and freshly ground black pepper, to taste
½ cup vegetable broth or water
2 tablespoons fresh parsley, chopped
Juice of ½ lemon

Ingredients for One-Pan Spiced Chickpea and Sweet Potato Hash

Instructions

Heat olive oil in a large skillet over medium heat.
Add diced sweet potatoes and cook, stirring occasionally, for about 8 minutes until they begin to soften and lightly brown.
Add the diced red onion and red bell pepper to the skillet. Cook for another 4-5 minutes, stirring occasionally, until the vegetables soften.
Stir in the minced garlic, ground cumin, smoked paprika, ground coriander, cayenne pepper (if using), salt, and black pepper. Cook for 1 minute until fragrant.
Add the drained chickpeas and vegetable broth. Stir well to combine.
Cover the skillet with a lid, reduce heat to low, and cook for 5-7 minutes until the sweet potatoes are tender and the broth has mostly evaporated.
Remove the lid; increase heat to medium-high and cook for another 2 minutes to let any remaining liquid evaporate and crisp the bottom slightly.
Remove from heat and stir in fresh parsley and lemon juice.
Taste and adjust seasoning as needed.
Serve warm as a satisfying vegetarian main dish or side.

One-Pan Spiced Chickpea and Sweet Potato Hash cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This quick and flavorful One-Pan Spiced Chickpea and Sweet Potato Hash is designed for effortless preparation and minimal cleanup.

Cookware Size Guidance

For the One-Pan Spiced Chickpea and Sweet Potato Hash serving 4 people, a 12-inch (30 cm) skillet with at least 2.5–3 quarts capacity is ideal.

Cookware Swap Guidance

easy, healthy, vegetarian, gluten-free, and family-friendly qualities: Nonstick Frying or Sauté Pan: Provides excellent heat control and prevents sticking, ideal if cast iron or stainless steel skillets aren’t available.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make One-Pan Spiced Chickpea and Sweet Potato Hash ahead?: Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?: Use a pan or pot named in the recipe and avoid crowding so the recipe cooks evenly.
How do I know it is done?: Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?: Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

To personalize the One-Pan Spiced Chickpea and Sweet Potato Hash while keeping it wholesome and flavorful, try these ingredient swaps that maintain the recipe’s vegetarian, gluten-free, and dairy-free profile:

Sweet Potatoes: Use butternut squash or orange-fleshed pumpkin for similar sweetness and texture.
Chickpeas: Swap with cooked white beans, black beans, or lentils for varied plant-based protein options.
Red Bell Pepper: Substitute with yellow or orange bell peppers, zucchini, or even diced carrots for variation in color and flavor.
Vegetable Broth: Water works fine; for non-vegetarian variations, low-sodium chicken broth adds depth.
Spices: If smoked paprika is unavailable, regular paprika or a pinch of chili powder provides smoky warmth.
Fresh Herbs: Cilantro or fresh mint offer refreshing alternatives to parsley.
Citrus: Lime juice can replace lemon juice for a bright acidic finish.

These swaps support dietary needs and enhance the recipe’s one-pan, quick, healthy, and family-friendly qualities for convenient weeknight cooking.

Storage and Reheating

Cool One-Pan Spiced Chickpea and Sweet Potato Hash before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

One-Pan Spiced Chickpea and Sweet Potato Hash

Recipe Details

Ingredients

Instructions