PanPotPlates

One-Pan Chicken

One-Pan Spiced Chickpea and Sweet Potato Hash

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 13, 2026 · Updated May 11, 2026
Middle Eastern-Inspired 30 mins onepanone-paneasyquickhealthyvegetarianglutenfreedairyfreefamily-friendlyweeknightlowcarbflavorfulmeatless

A quick and healthy Middle Eastern-inspired chickpea and sweet potato hash cooked entirely in one skillet. This easy, gluten-free, dairy-free, and vegetarian recipe is bursting with flavorful spices, perfect for busy weeknight dinners and wholesome family meals.

One-Pan Spiced Chickpea and Sweet Potato Hash
Prep 10 min
Cook 20 min
Total 30 min
Servings 4
Difficulty easy
Cuisine Middle Eastern-Inspired

Recipe Details

Prep10 min
Cook20 min
Total30 min
Servings4
Difficultyeasy
CuisineMiddle Eastern-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1 tablespoon olive oil
  • 1 large sweet potato, peeled and diced into ½-inch cubes
  • 1 small red onion, diced
  • 3 garlic cloves, minced
  • 1 (15-ounce) can chickpeas, drained and rinsed
  • 1 red bell pepper, diced
  • 1 teaspoon ground cumin
  • 1 teaspoon smoked paprika
  • ½ teaspoon ground coriander
  • ¼ teaspoon cayenne pepper (optional, adjust to taste)
  • Salt and freshly ground black pepper, to taste
  • ½ cup vegetable broth or water
  • 2 tablespoons fresh parsley, chopped
  • Juice of ½ lemon

Instructions

  1. Heat olive oil in a large skillet over medium heat.
  2. Add diced sweet potatoes and cook, stirring occasionally, for about 8 minutes until they begin to soften and lightly brown.
  3. Add the diced red onion and red bell pepper to the skillet. Cook for another 4-5 minutes, stirring occasionally, until the vegetables soften.
  4. Stir in the minced garlic, ground cumin, smoked paprika, ground coriander, cayenne pepper (if using), salt, and black pepper. Cook for 1 minute until fragrant.
  5. Add the drained chickpeas and vegetable broth. Stir well to combine.
  6. Cover the skillet with a lid, reduce heat to low, and cook for 5-7 minutes until the sweet potatoes are tender and the broth has mostly evaporated.
  7. Remove the lid; increase heat to medium-high and cook for another 2 minutes to let any remaining liquid evaporate and crisp the bottom slightly.
  8. Remove from heat and stir in fresh parsley and lemon juice.
  9. Taste and adjust seasoning as needed.
  10. Serve warm as a satisfying vegetarian main dish or side.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

To personalize the One-Pan Spiced Chickpea and Sweet Potato Hash while keeping it wholesome and flavorful, try these ingredient swaps that maintain the recipe’s vegetarian, gluten-free, and dairy-free profile:

  • Sweet Potatoes: Use butternut squash or orange-fleshed pumpkin for similar sweetness and texture.
  • Chickpeas: Swap with cooked white beans, black beans, or lentils for varied plant-based protein options.
  • Red Bell Pepper: Substitute with yellow or orange bell peppers, zucchini, or even diced carrots for variation in color and flavor.
  • Vegetable Broth: Water works fine; for non-vegetarian variations, low-sodium chicken broth adds depth.
  • Spices: If smoked paprika is unavailable, regular paprika or a pinch of chili powder provides smoky warmth.
  • Fresh Herbs: Cilantro or fresh mint offer refreshing alternatives to parsley.
  • Citrus: Lime juice can replace lemon juice for a bright acidic finish.

These swaps support dietary needs and enhance the recipe’s one-pan, quick, healthy, and family-friendly qualities for convenient weeknight cooking.

Pan Or Pot Required

This quick and flavorful One-Pan Spiced Chickpea and Sweet Potato Hash is designed for effortless preparation and minimal cleanup. Use a large, deep skillet with a tight-fitting lid to achieve the perfect balance of tender vegetables and crispy edges.

  • Skillet size: A 10 to 12-inch heavy-bottomed skillet is optimal to ensure even cooking and sufficient space to prevent overcrowding.
  • Lid: Essential for steaming the sweet potatoes until tender and allowing the rich spices and broth to penetrate fully into the chickpeas and vegetables.

Opting for a skillet over a pot enhances texture by creating lightly crisped bits on the bottom while maintaining moistness. This method supports the recipe’s focus on a one-pan, quick, healthy, and easy meal ideal for busy weeknights or family dinners.

Cookware Size Guidance

For the One-Pan Spiced Chickpea and Sweet Potato Hash serving 4 people, a 12-inch (30 cm) skillet with at least 2.5–3 quarts capacity is ideal. This size ensures even heat distribution for perfectly cooked sweet potatoes and sautéed bell peppers without crowding.

If you own a smaller skillet (around 10 inches), you might consider cooking in batches or reducing ingredient amounts to avoid steaming instead of sautéing. Conversely, with a pan larger than 12 inches, ingredients could cook too quickly or spread too thinly; adjust cooking temperature carefully to prevent burning.

Choose a heavy-bottomed pan, preferably non-stick or well-seasoned cast iron, to optimize heat retention and develop the signature texture of this flavorful, quick, and nutritious one-pan dinner.

Cookware Swap Guidance

While the recipe is designed for a skillet, these alternative cookware options preserve the dish’s quick, easy, healthy, vegetarian, gluten-free, and family-friendly qualities:

  • Nonstick Frying or Sauté Pan: Provides excellent heat control and prevents sticking, ideal if cast iron or stainless steel skillets aren’t available.
  • Casserole Dish (Oven Baking): Sauté ingredients first, then transfer to a covered casserole dish and bake at 375°F (190°C) for 20–25 minutes until sweet potatoes are tender. Uncover and bake briefly to crisp the top.
  • Sheet Pan Roasting: Toss all ingredients on a rimmed sheet pan, drizzle with oil and spices, then roast at 425°F (220°C) for 25–30 minutes, stirring halfway through.
  • Slow Cooker: Combine all ingredients except lemon juice and parsley; cook on low for 4–5 hours or high for 2–3 hours before stirring in fresh herbs for a comforting, hands-off meal.
  • Instant Pot / Pressure Cooker: Use sauté mode to brown aromatics and spices; add chickpeas, sweet potatoes, and broth. Pressure cook on high for 5 minutes with quick release. Finish with fresh parsley and lemon juice.

Adjust liquids and cooking times accordingly for best results with each method.

Leftovers Quality

This flavorful One-Pan Spiced Chickpea and Sweet Potato Hash stays fresh as leftovers for 3–4 days when refrigerated in an airtight container. Flavors deepen and textures remain hearty.

Freeze leftovers in sealed containers for up to 2 months. Thaw overnight in the refrigerator before gently reheating.

To reheat, warm slowly in a skillet over medium heat, stirring occasionally to maintain the slightly crisp texture on the sweet potatoes. Alternatively, microwave covered and stir halfway through. Finish with a squeeze of fresh lemon juice or sprinkle of parsley to revive brightness.

This recipe works wonderfully for meal prep, offering a nutritious, gluten-free, dairy-free, vegetarian option that keeps well and reheats deliciously.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.