PanPotPlates

Skillet Meals

Skillet Sweet Potato and Chickpea Breakfast Hash

By PanPotPlates Editorial TeamPublished Apr 26, 2026 | Updated May 12, 2026
American-Inspired 25 mins onepanskilleteasyquickhealthyvegetarianfamily-friendlykid-friendlybudget-friendlybreakfastlowcarb

This easy skillet breakfast hash features tender sweet potatoes and protein-packed chickpeas sautéed with aromatic spices and fresh veggies for a nutritious, family-friendly start to your day. Perfect for quick, budget-friendly mornings with wholesome flavor.

Skillet Sweet Potato and Chickpea Breakfast Hash
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine American-Inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineAmerican-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1 tbsp olive oil
  • 1 medium sweet potato, peeled and diced into 1/2-inch cubes
  • 1 small red bell pepper, diced
  • 1 small yellow onion, diced
  • 2 cloves garlic, minced
  • 1 tsp ground cumin
  • 1/2 tsp smoked paprika
  • 1/4 tsp ground black pepper
  • 1/4 tsp salt, or to taste
  • 1 can (15 oz) chickpeas, drained and rinsed
  • 2 cups fresh baby spinach
  • 2 large eggs (optional, for topping)
  • Fresh parsley or cilantro for garnish (optional)
Ingredients for Skillet Sweet Potato and Chickpea Breakfast Hash
Ingredients for Skillet Sweet Potato and Chickpea Breakfast Hash

Instructions

  1. Heat olive oil in a large skillet over medium heat.
  2. Add diced sweet potatoes and cook for about 8 minutes, stirring occasionally, until they start to soften and become lightly golden.
  3. Add diced onion and red bell pepper; cook for 4-5 minutes until softened.
  4. Stir in minced garlic, ground cumin, smoked paprika, black pepper, and salt. Cook for 1 minute until fragrant.
  5. Add chickpeas and cook for another 3-4 minutes, stirring occasionally to warm through and combine flavors.
  6. Add fresh baby spinach and cook until just wilted, about 1-2 minutes.
  7. If using eggs, create two small wells in the hash and crack one egg into each. Cover the skillet and cook for 3-4 minutes or until eggs reach your preferred doneness.
  8. Remove from heat, garnish with fresh parsley or cilantro if desired, and serve immediately.
Skillet Sweet Potato and Chickpea Breakfast Hash cooking in the recommended pan or pot
Skillet Sweet Potato and Chickpea Breakfast Hash cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is designed as a perfect one-pan skillet meal , requiring a large skillet for optimal cooking results.

Cookware Size Guidance

For this Skillet Sweet Potato and Chickpea Breakfast Hash , a 10 to 12-inch (25 to 30 cm) heavy-bottomed skillet is recommended.

Cookware Swap Guidance

This Skillet Sweet Potato and Chickpea Breakfast Hash is ideally cooked in a large skillet for even heat and easy stirring.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Skillet Sweet Potato and Chickpea Breakfast Hash ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a wide skillet and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize your Skillet Sweet Potato and Chickpea Breakfast Hash to suit dietary preferences or available ingredients with these flexible swaps, ensuring the meal remains quick, healthy, and family-friendly:

  • Sweet Potato: Replace with butternut squash or regular potatoes for varying texture and flavor. For lower-carb options, try cauliflower florets.
  • Chickpeas: Use black beans, cannellini beans, or lentils as protein-rich alternatives.
  • Bell Pepper: Any bell pepper color works; alternatively, use diced zucchini or mushrooms for added variety.
  • Spinach: Substitute with kale, Swiss chard, or arugula depending on season and taste.
  • Eggs (optional): For vegan or egg-free versions, omit eggs or use tofu scramble or seasoned chickpea pancakes.
  • Olive Oil: Swap with avocado or coconut oil for different flavor profiles and healthy fat options.

These ingredient swaps keep the recipe easy, quick, and family-friendly while maintaining wholesome flavor and nutrition.

Storage and Reheating

Cool Skillet Sweet Potato and Chickpea Breakfast Hash before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.