PanPotPlates
Back to Recipes

Skillet Meals

Skillet Sweet Potato and Chickpea Breakfast Hash

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 26, 2026 · Updated May 12, 2026
American-Inspired 25 mins onepanskilleteasyquickhealthyvegetarianfamily-friendlykid-friendlybudget-friendlybreakfastlowcarb

This easy skillet breakfast hash features tender sweet potatoes and protein-packed chickpeas sautéed with aromatic spices and fresh veggies for a nutritious, family-friendly start to your day. Perfect for quick, budget-friendly mornings with wholesome flavor.

Skillet Sweet Potato and Chickpea Breakfast Hash
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine American-Inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineAmerican-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1 tbsp olive oil
  • 1 medium sweet potato, peeled and diced into 1/2-inch cubes
  • 1 small red bell pepper, diced
  • 1 small yellow onion, diced
  • 2 cloves garlic, minced
  • 1 tsp ground cumin
  • 1/2 tsp smoked paprika
  • 1/4 tsp ground black pepper
  • 1/4 tsp salt, or to taste
  • 1 can (15 oz) chickpeas, drained and rinsed
  • 2 cups fresh baby spinach
  • 2 large eggs (optional, for topping)
  • Fresh parsley or cilantro for garnish (optional)

Instructions

  1. Heat olive oil in a large skillet over medium heat.
  2. Add diced sweet potatoes and cook for about 8 minutes, stirring occasionally, until they start to soften and become lightly golden.
  3. Add diced onion and red bell pepper; cook for 4-5 minutes until softened.
  4. Stir in minced garlic, ground cumin, smoked paprika, black pepper, and salt. Cook for 1 minute until fragrant.
  5. Add chickpeas and cook for another 3-4 minutes, stirring occasionally to warm through and combine flavors.
  6. Add fresh baby spinach and cook until just wilted, about 1-2 minutes.
  7. If using eggs, create two small wells in the hash and crack one egg into each. Cover the skillet and cook for 3-4 minutes or until eggs reach your preferred doneness.
  8. Remove from heat, garnish with fresh parsley or cilantro if desired, and serve immediately.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize your Skillet Sweet Potato and Chickpea Breakfast Hash to suit dietary preferences or available ingredients with these flexible swaps, ensuring the meal remains quick, healthy, and family-friendly:

  • Sweet Potato: Replace with butternut squash or regular potatoes for varying texture and flavor. For lower-carb options, try cauliflower florets.
  • Chickpeas: Use black beans, cannellini beans, or lentils as protein-rich alternatives.
  • Bell Pepper: Any bell pepper color works; alternatively, use diced zucchini or mushrooms for added variety.
  • Spinach: Substitute with kale, Swiss chard, or arugula depending on season and taste.
  • Eggs (optional): For vegan or egg-free versions, omit eggs or use tofu scramble or seasoned chickpea pancakes.
  • Olive Oil: Swap with avocado or coconut oil for different flavor profiles and healthy fat options.

These ingredient swaps keep the recipe easy, quick, and family-friendly while maintaining wholesome flavor and nutrition.

Pan Or Pot Required

This recipe is designed as a perfect one-pan skillet meal, requiring a large skillet for optimal cooking results. A wide, heavy-bottomed skillet such as non-stick or cast iron ensures even heat distribution, allowing diced sweet potatoes to cook tender and golden while easily combining other flavorful ingredients. Using a skillet simplifies preparation, minimizes cleanup, and complements this recipe’s quick, budget-conscious, and family-friendly appeal.

If cooking the optional eggs on top, using a skillet lid helps cover the pan to cook eggs evenly without needing a separate pan.

Overall, a skillet is essential to achieve the ideal texture, balanced flavors, and cooking efficiency for this Skillet Sweet Potato and Chickpea Breakfast Hash.

Cookware Size Guidance

For this Skillet Sweet Potato and Chickpea Breakfast Hash, a 10 to 12-inch (25 to 30 cm) heavy-bottomed skillet is recommended. This size allows enough space to sauté diced sweet potatoes and chickpeas evenly without overcrowding, promoting proper caramelization and a desirable texture while leaving room for spinach and optional eggs.

Using a skillet smaller than 10 inches may cause overcrowding and steaming instead of sautéing, which can dull flavor and reduce crispness. Avoid overly large pans, as a moderate ingredient layer ensures better browning.

Cast iron, heavy stainless steel, or nonstick pans are excellent choices. Nonstick pans facilitate easy cleanup and often require less added oil, enhancing this recipe’s healthy and convenient qualities.

Cookware Swap Guidance

This Skillet Sweet Potato and Chickpea Breakfast Hash is ideally cooked in a large skillet for even heat and easy stirring. If you don’t have a skillet, suitable alternatives that preserve the recipe’s quick, easy, and family-friendly nature include:

  • Large sauté pan: Offers enough cooking surface and even heat. Use a lid if cooking eggs on top.
  • Cast iron pan: Retains heat well and enhances flavor. Ensure it’s well-seasoned for best results.
  • Nonstick frying pan: Easier cleanup and helpful for healthy, low-carb cooking.
  • Oven-safe casserole dish: Sauté ingredients on stovetop, then transfer to casserole, add eggs, and bake to finish.
  • Sheet pan with sides: Roast ingredients in the oven, stirring halfway for even cooking.

Choosing cookware that fits the onepan and skillet concept keeps this recipe simple, quick, and minimizes cleanup, aligning with PanPotPlates’ focus on easy, family-friendly skillet meals.

Leftovers Quality

This hearty sweet potato and chickpea hash keeps well for up to 3 days stored in an airtight container in the refrigerator. The sweet potatoes and chickpeas retain texture and flavor, making it excellent for nutritious leftovers or meal prep.

For best results, cool leftovers to room temperature before refrigerating. Reheat gently in a skillet over medium heat, stirring occasionally to maintain texture and flavor. If eggs were included, it's best to reheat them separately or omit during reheating for a vegan-friendly option.

The hash also freezes well for up to 1 month when stored in freezer-safe containers. Thaw overnight in the refrigerator before reheating on the stovetop to preserve freshness and tenderness.

This easy, budget-friendly skillet breakfast fits consistently into busy weeknight or meal prep routines, delivering satisfying, wholesome comfort food with minimal effort.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.