PanPotPlates
Back to Recipes

One-Pot Pasta

One-Pot Asian-Inspired Sesame Chicken and Vegetable Stir-Fry

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 24, 2026 · Updated May 12, 2026
Asian-Inspired 35 mins onepoteasyquickhealthyfamily-friendlyhighproteinflavorfulweeknightleftovers

This quick and flavorful one-pot pasta recipe combines tender chicken breast, fresh vegetables, and a rich sesame sauce for a high-protein, family-friendly meal. Perfect for busy weeknights and great for tasty leftovers.

One-Pot Asian-Inspired Sesame Chicken and Vegetable Stir-Fry
Prep 15 min
Cook 20 min
Total 35 min
Servings 4
Difficulty easy
Cuisine Asian-Inspired

Recipe Details

Prep15 min
Cook20 min
Total35 min
Servings4
Difficultyeasy
CuisineAsian-Inspired
Add To Favorites

Ingredients

Servings 4
  • 2 tablespoons sesame oil
  • 1 lb boneless, skinless chicken breasts, thinly sliced
  • 3 garlic cloves, minced
  • 1 tablespoon fresh ginger, grated
  • 1 medium red bell pepper, thinly sliced
  • 1 medium yellow bell pepper, thinly sliced
  • 1 medium carrot, julienned
  • 1 cup snap peas, trimmed
  • 4 cups baby spinach
  • 8 oz dry thin spaghetti or angel hair pasta
  • 3 1/2 cups low-sodium chicken broth
  • 1/4 cup low-sodium soy sauce
  • 2 tablespoons hoisin sauce
  • 1 tablespoon rice vinegar
  • 1 tablespoon honey
  • 1 tablespoon toasted sesame seeds, plus more for garnish
  • 2 green onions, thinly sliced
  • Salt and black pepper, to taste
  • Red pepper flakes (optional, to taste)

Instructions

  1. Heat the sesame oil in a large deep skillet or wide pot over medium-high heat.
  2. Add the sliced chicken, season with salt and pepper, and cook for about 5 minutes, stirring occasionally, until mostly cooked through and lightly browned. Remove chicken and set aside.
  3. In the same pot, sauté the minced garlic and grated ginger for 30 seconds until fragrant.
  4. Add the sliced red and yellow bell peppers, carrot, and snap peas. Cook for 3-4 minutes, stirring frequently, until vegetables are tender-crisp.
  5. Return the chicken to the pot. Add dry pasta, chicken broth, soy sauce, hoisin sauce, rice vinegar, and honey. Stir well to combine all ingredients evenly.
  6. Bring to a boil, then reduce heat to medium-low, cover, and simmer for 9-11 minutes, stirring halfway through, until the pasta is fully cooked and most liquid is absorbed.
  7. Stir in baby spinach and toasted sesame seeds. Cook for 1-2 minutes until spinach wilts.
  8. Adjust seasoning with salt, black pepper, and red pepper flakes if using.
  9. Remove from heat and garnish with sliced green onions and extra toasted sesame seeds before serving.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Adapt this One-Pot Asian-Inspired Sesame Chicken and Vegetable Stir-Fry to suit different diets or ingredient preferences with these substitutions:

  • Chicken: Replace with firm tofu or tempeh for vegetarian or vegan versions; shrimp or firm white fish for pescatarian options.
  • Sesame oil: Use avocado or grapeseed oil if avoiding nuts or seeking a milder flavor.
  • Soy sauce: Substitute tamari or coconut aminos for gluten- and soy-free alternatives.
  • Hoisin sauce: Use a blend of miso paste and molasses or maple syrup for a sweet-savory flavor without packaged sauces.
  • Honey: Replace with maple syrup or agave nectar to keep the dish vegan and dairy-free.
  • Pasta: Swap for gluten-free pasta or spiralized vegetables like zucchini noodles for a low-carb option.
  • Vegetables: Use seasonal or preferred vegetables such as broccoli, baby bok choy, or mushrooms for variety and color.

These replacements maintain the meal's quick, easy, and flavorful qualities while expanding appeal across vegan, gluten-free, dairy-free, and kid-friendly diets.

Pan Or Pot Required

This recipe is crafted as a One-Pot Pasta dish, best prepared in a large, deep skillet or wide pot such as a sauté pan with high sides or a deep skillet. This cookware is ideal for simultaneously sautéing chicken and vegetables and simmering the pasta.

Use a pan or pot with sufficient surface area to brown the chicken evenly and enough depth to hold liquid for cooking the pasta thoroughly. A non-stick or stainless steel pan with a lid will help achieve even cooking and simplify cleanup. This one-pot method saves time and reduces mess, making it excellent for quick, healthy weeknight meals.

Ensure your chosen cookware fits all ingredients comfortably without overcrowding to allow pasta to cook properly in the broth alongside vegetables and chicken. Using the lid helps maintain moisture and heat for tender pasta and crisp-tender vegetables.

In summary, a single large deep skillet or wide pot is all you need for this quick, flavorful, and family-friendly one-pot dinner.

Cookware Size Guidance

For this One-Pot Pasta recipe serving 4, a large deep skillet or wide pot with at least 4 to 5 quarts (4–5 liters) capacity is recommended. This size accommodates sautéing chicken and vegetables and boiling pasta without overcrowding, ensuring even cooking and avoiding spills.

A too-small pan may crowd ingredients, leading to uneven cooking or difficulty in liquid absorption for pasta. Select a non-stick or heavy-bottomed pan to prevent sticking and promote uniform heat distribution.

If unavailable, alternatives like a large sauté pan or Dutch oven work well. Key is a single piece of cookware large enough to hold 3 1/2 cups chicken broth plus vegetables and pasta for smooth one-pot cooking.

Cookware Swap Guidance

This recipe yields best results using a large deep skillet or wide pot suitable for sautéing and simmering all ingredients together — classic cookware for One-Pot Pasta dishes. If you don’t have a deep skillet or wide pot, consider these options:

  • Large Dutch Oven: Offers excellent heat retention and capacity for cooking chicken, vegetables, and pasta simultaneously, perfect for a onepot, healthy, and family-friendly meal.
  • Large Sauté Pan with Lid: Provides sufficient depth and a lid to stir vegetables and liquids comfortably without overflow.
  • Large Deep Frying Pan: If your skillet lacks depth, a deep frying pan with sloping sides helps prevent splatter and allows easier stirring.

Avoid shallow pans or those without lids since simmering pasta requires covered cooking. Slow cookers or Instant Pots are less ideal due to the stovetop control and stirring necessary for even results.

Using appropriate one-pot cookware ensures a quick, easy, healthy, and flavorful stir-fry that locks in vibrant flavors and tender textures—making this a standout weeknight meal with great leftovers.

Leftovers Quality

This One-Pot Asian-Inspired Sesame Chicken and Vegetable Stir-Fry makes excellent leftovers perfect for meal prep and busy weeknight planning. When stored correctly, leftovers remain fresh for 3 to 4 days refrigerated.

To store, cool the stir-fry to room temperature, transfer to an airtight container, and refrigerate within two hours of cooking. Keep the dish slightly moist to prevent pasta from drying out. For freezing, divide into freezer-safe containers or bags and freeze up to 1 month; thaw overnight in the fridge before reheating.

Reheat by warming gently in a skillet over medium heat, adding a splash of water or low-sodium chicken broth to loosen the sauce and preserve tender pasta. Stir frequently for even heating. Alternatively, microwave covered loosely with a microwave-safe lid or damp cloth, stirring halfway through. Avoid overheating to maintain crisp vegetables and juicy chicken, preserving the dish's fresh, flavorful profile so leftovers taste as good as fresh.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.