What cookware works best?

Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.

How do I know it is done?

Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.

Can I adjust the seasoning?

Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Back to Recipes

One-Pot Pasta

One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice

Name: One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice
Prep time: 10 min
Cook time: 30 min
Total time: 40 min
Yield: 4 servings
Cuisine: Asian-Inspired
Ingredients: 4 salmon fillets (6 oz each), skin-on; 2 cups broccoli florets; 1 cup jasmine rice, rinsed and drained; 1 ½ cups low-sodium chicken or vegetable broth; 3 tbsp soy sauce (or tamari for gluten-free); 2 tbsp honey or maple syrup; 1 tbsp rice vinegar; 1 tsp toasted sesame oil; 2 cloves garlic, minced; 1 tsp fresh ginger, grated; 1 tbsp olive oil; 1 tsp sesame seeds, for garnish; 2 green onions, thinly sliced for garnish; Salt and freshly ground black pepper, to taste

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 18, 2026 · Updated May 11, 2026

Asian-Inspired 40 mins onepansheetpaneasyquickhealthyfamily-friendlyglutenfreedairyfreepescatarianweeknightflavorfullighttimessaver

A quick, healthy one-pan teriyaki glazed salmon recipe paired with roasted broccoli and fragrant jasmine rice—a flavorful Asian-inspired meal perfect for busy weeknights and family dinners.

One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice

Prep 10 min

Cook 30 min

Total 40 min

Servings 4

Difficulty easy

Cuisine Asian-Inspired

Ingredients

Servings 4

4 salmon fillets (6 oz each), skin-on
2 cups broccoli florets
1 cup jasmine rice, rinsed and drained
1 ½ cups low-sodium chicken or vegetable broth
3 tbsp soy sauce (or tamari for gluten-free)
2 tbsp honey or maple syrup
1 tbsp rice vinegar
1 tsp toasted sesame oil
2 cloves garlic, minced
1 tsp fresh ginger, grated
1 tbsp olive oil
1 tsp sesame seeds, for garnish
2 green onions, thinly sliced for garnish
Salt and freshly ground black pepper, to taste

Ingredients for One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice

Instructions

Preheat oven to 400°F (200°C).
In a small bowl, whisk together soy sauce, honey or maple syrup, rice vinegar, toasted sesame oil, minced garlic, and grated ginger to form the teriyaki glaze.
Lightly grease a large rimmed sheet pan or wide baking dish with olive oil.
Evenly spread rinsed jasmine rice across the bottom of the pan.
Pour broth over the rice, season lightly with salt and freshly ground black pepper.
Arrange broccoli florets on one side of the rice evenly.
Place salmon fillets skin-side down on the opposite side of the rice.
Brush each salmon fillet generously with the teriyaki glaze, reserving 1 tablespoon for later.
Drizzle olive oil over the broccoli and season with salt and pepper to taste.
Cover the pan tightly with aluminum foil and bake for 20 minutes.
Remove foil, spoon reserved teriyaki glaze over salmon again, then bake uncovered for an additional 8-10 minutes or until salmon is cooked through and rice is tender.
Sprinkle sesame seeds and sliced green onions over salmon and broccoli before serving.
Serve directly from the pan for a fuss-free, easy cleanup dinner. Enjoy!

One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe requires a large rimmed sheet pan or a wide, shallow baking dish —perfect for layering jasmine rice, broccoli, and salmon into a flavorful one-pan meal.

Cookware Size Guidance

To ensure even cooking and avoid overcrowding in this one-pan teriyaki salmon recipe (serves 4), use a large rimmed sheet pan or baking dish at least 12 x 17 inches (30 x 43 cm) .

Cookware Swap Guidance

u don’t have a rimmed sheet pan for this dish, suitable alternatives include: Oven-safe skillet: A large cast iron or enameled steel pan works well for even heat distribution and accommodates all ingredients in one layer.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice ahead?: Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?: Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.
How do I know it is done?: Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?: Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice to suit your preferences or dietary needs with these substitutions:

Salmon fillets: Swap with cod, halibut, or tilapia for other pescatarian options; use marinated tofu or tempeh for a vegan version.
Broccoli florets: Substitute with green beans, asparagus, or Brussels sprouts for a similar texture and flavor.
Jasmine rice: Brown rice or quinoa add fiber and protein, while cauliflower rice offers a low-carb alternative.
Broth: Use water with added herbs or low-sodium broth to control salt content.
Soy sauce (or tamari): Tamari is gluten-free; coconut aminos is a tasty soy-free choice.
Honey or maple syrup: Maple syrup keeps it vegan; agave nectar or brown sugar work well too.
Rice vinegar: Apple cider or white wine vinegar make flavorful substitutes.
Toasted sesame oil: Use walnut, peanut oil, or omit if unavailable.
Sesame seeds and green onions garnish: Replace with toasted pumpkin seeds or chopped chives.

These swaps maintain a quick, easy, and nutritious family-friendly dinner while accommodating gluten-free, dairy-free, vegan, and pescatarian diets.

Storage and Reheating

Cool One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice

Recipe Details

Ingredients

Instructions