Cooking Techniques
PanPotPlates
One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice
By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 18, 2026 · Updated May 11, 2026
Asian-Inspired
40 mins
onepansheetpaneasyquickhealthyfamily-friendlyglutenfreedairyfreepescatarianweeknightflavorfullighttimessaver
A quick, healthy one-pan teriyaki glazed salmon recipe paired with roasted broccoli and fragrant jasmine rice—a flavorful Asian-inspired meal perfect for busy weeknights and family dinners.
Prep
10 min
Cook
30 min
Total
40 min
Servings
4
Difficulty
easy
Cuisine
Asian-Inspired
Ingredients
Servings
4
- 4 salmon fillets (6 oz each), skin-on
- 2 cups broccoli florets
- 1 cup jasmine rice, rinsed and drained
- 1 ½ cups low-sodium chicken or vegetable broth
- 3 tbsp soy sauce (or tamari for gluten-free)
- 2 tbsp honey or maple syrup
- 1 tbsp rice vinegar
- 1 tsp toasted sesame oil
- 2 cloves garlic, minced
- 1 tsp fresh ginger, grated
- 1 tbsp olive oil
- 1 tsp sesame seeds, for garnish
- 2 green onions, thinly sliced for garnish
- Salt and freshly ground black pepper, to taste
Instructions
-
Preheat oven to 400°F (200°C).
-
In a small bowl, whisk together soy sauce, honey or maple syrup, rice vinegar, toasted sesame oil, minced garlic, and grated ginger to form the teriyaki glaze.
-
Lightly grease a large rimmed sheet pan or wide baking dish with olive oil.
-
Evenly spread rinsed jasmine rice across the bottom of the pan.
-
Pour broth over the rice, season lightly with salt and freshly ground black pepper.
-
Arrange broccoli florets on one side of the rice evenly.
-
Place salmon fillets skin-side down on the opposite side of the rice.
-
Brush each salmon fillet generously with the teriyaki glaze, reserving 1 tablespoon for later.
-
Drizzle olive oil over the broccoli and season with salt and pepper to taste.
-
Cover the pan tightly with aluminum foil and bake for 20 minutes.
-
Remove foil, spoon reserved teriyaki glaze over salmon again, then bake uncovered for an additional 8-10 minutes or until salmon is cooked through and rice is tender.
-
Sprinkle sesame seeds and sliced green onions over salmon and broccoli before serving.
-
Serve directly from the pan for a fuss-free, easy cleanup dinner. Enjoy!
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize this One-Pan Teriyaki Glazed Salmon with Roasted Broccoli and Jasmine Rice to suit your preferences or dietary needs with these substitutions:
- Salmon fillets: Swap with cod, halibut, or tilapia for other pescatarian options; use marinated tofu or tempeh for a vegan version.
- Broccoli florets: Substitute with green beans, asparagus, or Brussels sprouts for a similar texture and flavor.
- Jasmine rice: Brown rice or quinoa add fiber and protein, while cauliflower rice offers a low-carb alternative.
- Broth: Use water with added herbs or low-sodium broth to control salt content.
- Soy sauce (or tamari): Tamari is gluten-free; coconut aminos is a tasty soy-free choice.
- Honey or maple syrup: Maple syrup keeps it vegan; agave nectar or brown sugar work well too.
- Rice vinegar: Apple cider or white wine vinegar make flavorful substitutes.
- Toasted sesame oil: Use walnut, peanut oil, or omit if unavailable.
- Sesame seeds and green onions garnish: Replace with toasted pumpkin seeds or chopped chives.
These swaps maintain a quick, easy, and nutritious family-friendly dinner while accommodating gluten-free, dairy-free, vegan, and pescatarian diets.
Pan Or Pot Required
This recipe requires a large rimmed sheet pan or a wide, shallow baking dish—perfect for layering jasmine rice, broccoli, and salmon into a flavorful one-pan meal. The rimmed sides keep rice and broth contained, allowing even roasting without spills.
The foil cover steams the rice and gently cooks the salmon before finishing uncovered to perfectly caramelize the teriyaki glaze and crisp the broccoli edges.
Ideal for those seeking a quick, easy, family-friendly, gluten-free, dairy-free, pescatarian, and healthy weeknight dinner, this one-pan approach minimizes cleanup while maximizing flavor and nutrition.
Cookware Size Guidance
To ensure even cooking and avoid overcrowding in this one-pan teriyaki salmon recipe (serves 4), use a large rimmed sheet pan or baking dish at least 12 x 17 inches (30 x 43 cm). This size allows the jasmine rice to cook evenly while providing space for 4 salmon fillets and crisp roasted broccoli placed side by side.
If substituting with a casserole dish, choose one with similar surface area and a depth of at least 2-3 inches to hold liquid and ingredients safely during baking without overflow.
Proper pan size is key to achieving tender, fluffy rice, perfectly roasted broccoli, and succulent, glazed salmon in one effortless dish.
Cookware Swap Guidance
If you don’t have a rimmed sheet pan for this dish, suitable alternatives include:
- Oven-safe skillet: A large cast iron or enameled steel pan works well for even heat distribution and accommodates all ingredients in one layer.
- Deep casserole dish: Glass or ceramic dishes with high sides trap moisture to steam rice and roast vegetables along with the salmon.
- Baking dish with lid or foil cover: If your dish has a lid, use it to cover the pan during the steaming phase; otherwise, aluminum foil is ideal.
Avoid using shallow pans without sides, as these can cause broth spillage and uneven cooking. These alternatives keep this recipe quick, easy, and perfect for busy weeknight meals.
Leftovers Quality
Store leftover teriyaki glazed salmon with roasted broccoli and jasmine rice in an airtight container in the refrigerator for up to 2 days. Consume within 48 hours to maintain freshness and food safety, especially for cooked fish.
Reheat gently in the microwave on medium power for 1-2 minutes, loosely covered to retain moisture and prevent overcooking. Alternatively, rewarm in a 300°F oven for 10-15 minutes until heated through.
Freezing is recommended only for the rice and broccoli (up to 1 month); separate the salmon before freezing, as frozen cooked fish may change in texture. Thaw overnight in the refrigerator before reheating.
Following these tips ensures your flavorful, family-friendly leftovers retain quality and taste.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Sheet Pan Dinners
Sheet Pan Ginger-Soy Glazed Mahi Mahi with Roasted Bok Choy
One-Pot Pasta
One-Pot Asian-Inspired Sesame Chicken and Vegetable Stir-Fry
Instant Pot Recipes
Instant Pot Orange-Glazed Tofu with Ginger Rice
One-Pot Pasta
One-Pan Cajun Blackened Catfish with Garlic Butter Okra
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register