PanPotPlates

One-Pot Pasta

One-Pot Spinach and Ricotta Stuffed Shells

By PanPotPlates Editorial TeamPublished Apr 10, 2026 | Updated Apr 11, 2026
Italian-Inspired 55 mins onepotvegetarianfamily-friendlyeasykid-friendlycomfortfoodleftovershighproteintimessaver

Enjoy an easy, one-pot recipe with jumbo pasta shells filled with a savory spinach and ricotta mixture, simmered in flavorful tomato sauce. This high-protein, vegetarian Italian-inspired meal is perfect for quick family dinners and picky eaters.

One-Pot Spinach and Ricotta Stuffed Shells
Prep 20 min
Cook 35 min
Total 55 min
Servings 6
Difficulty easy
Cuisine Italian-Inspired

Recipe Details

Prep20 min
Cook35 min
Total55 min
Servings6
Difficultyeasy
CuisineItalian-Inspired
Add To Favorites

Ingredients

Servings 6
  • 20 jumbo pasta shells
  • 1 tablespoon olive oil
  • 1 small onion, finely chopped
  • 2 cups fresh spinach, chopped
  • 1 1/2 cups ricotta cheese
  • 1 cup shredded mozzarella cheese, divided
  • 1/2 cup grated Parmesan cheese, divided
  • 2 cups tomato sauce, plus extra for serving
  • 1 teaspoon dried Italian seasoning
  • 1/2 teaspoon salt
  • 1/4 teaspoon ground black pepper
  • 2 1/2 cups water
Ingredients for One-Pot Spinach and Ricotta Stuffed Shells
Ingredients for One-Pot Spinach and Ricotta Stuffed Shells

Instructions

  1. Preheat oven to 375°F (190°C).
  2. Bring a large pot of salted water to a boil. Cook jumbo pasta shells until al dente, about 8-10 minutes. Drain and rinse with cold water to stop cooking. Set aside.
  3. In the same large pot, heat olive oil over medium heat. Sauté chopped onion for 3-4 minutes until translucent.
  4. Add chopped spinach and cook for 2 minutes until wilted. Remove pot from heat and cool slightly.
  5. In a large bowl, mix ricotta cheese, half of the mozzarella (1/2 cup), half of the Parmesan (1/4 cup), cooked spinach and onions, Italian seasoning, salt, and black pepper until well combined.
  6. Stuff each cooked shell with 1-2 tablespoons of the ricotta-spinach filling. Set aside.
  7. Spread 1 cup of tomato sauce evenly on the bottom of the large pot.
  8. Arrange stuffed shells in a single layer over the sauce.
  9. Gently pour 2 1/2 cups water over the shells without displacing them. Drizzle the remaining 1 cup tomato sauce evenly on top.
  10. Cover the pot with a lid and bring to a simmer over medium heat.
  11. Simmer gently for 25 minutes until shells are tender and filling is heated through.
  12. Remove lid and sprinkle remaining mozzarella (1/2 cup) and Parmesan (1/4 cup) over shells.
  13. Cover and cook for 5 more minutes until cheese melts and bubbles.
  14. Let the dish rest off heat for 5 minutes before serving. Serve with warmed extra tomato sauce if desired.
One-Pot Spinach and Ricotta Stuffed Shells cooking in the recommended pan or pot
One-Pot Spinach and Ricotta Stuffed Shells cooking in the recommended pan or pot

Tips

Pan Or Pot Required

Prepare this One-Pot Spinach and Ricotta Stuffed Shells recipe using a large, heavy-bottomed pot with a fitted lid .

Cookware Size Guidance

To serve 6 people, use a pot with a minimum capacity of 5 to 6 quarts (about 5 to 6 liters).

Cookware Swap Guidance

you don't have one, these alternatives work while maintaining ease and cleanup: Deep sauté pan or large covered skillet: Should be deep enough to hold water and arranged shells in a single layer, with a lid to trap steam.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make One-Pot Spinach and Ricotta Stuffed Shells ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this one-pot vegetarian pasta recipe with these ingredient swaps for dietary needs or ingredient availability:

  • Ricotta cheese: Replace with vegan ricotta made from cashews or tofu; cottage cheese is a lighter option but alters texture.
  • Spinach: Substitute kale, Swiss chard, or thawed frozen spinach for freshness and variety.
  • Mozzarella and Parmesan cheeses: Use nutritional yeast or vegan shredded cheese alternatives for dairy-free versions.
  • Jumbo pasta shells: Try large manicotti tubes or big rigatoni if shells are unavailable.
  • Tomato sauce:
  • Olive oil: Mild vegetable or avocado oils work as alternatives.

These substitutions help keep the meal easy, family-friendly, high-protein, and adaptable to vegetarian, vegan, or dairy-free diets without compromising flavor or simplicity.

Storage and Reheating

Cool One-Pot Spinach and Ricotta Stuffed Shells before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.