PanPotPlates

One-Pot Pasta

One-Pot Spinach and Ricotta Stuffed Shells

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 10, 2026 · Updated Apr 11, 2026
Italian-Inspired 55 mins onepotvegetarianfamily-friendlyeasykid-friendlycomfortfoodleftovershighproteintimessaver

Enjoy an easy, one-pot recipe with jumbo pasta shells filled with a savory spinach and ricotta mixture, simmered in flavorful tomato sauce. This high-protein, vegetarian Italian-inspired meal is perfect for quick family dinners and picky eaters.

One-Pot Spinach and Ricotta Stuffed Shells
Prep 20 min
Cook 35 min
Total 55 min
Servings 6
Difficulty easy
Cuisine Italian-Inspired

Recipe Details

Prep20 min
Cook35 min
Total55 min
Servings6
Difficultyeasy
CuisineItalian-Inspired
Add To Favorites

Ingredients

Servings 6
  • 20 jumbo pasta shells
  • 1 tablespoon olive oil
  • 1 small onion, finely chopped
  • 2 cups fresh spinach, chopped
  • 1 1/2 cups ricotta cheese
  • 1 cup shredded mozzarella cheese, divided
  • 1/2 cup grated Parmesan cheese, divided
  • 2 cups tomato sauce, plus extra for serving
  • 1 teaspoon dried Italian seasoning
  • 1/2 teaspoon salt
  • 1/4 teaspoon ground black pepper
  • 2 1/2 cups water

Instructions

  1. Preheat oven to 375°F (190°C).
  2. Bring a large pot of salted water to a boil. Cook jumbo pasta shells until al dente, about 8-10 minutes. Drain and rinse with cold water to stop cooking. Set aside.
  3. In the same large pot, heat olive oil over medium heat. Sauté chopped onion for 3-4 minutes until translucent.
  4. Add chopped spinach and cook for 2 minutes until wilted. Remove pot from heat and cool slightly.
  5. In a large bowl, mix ricotta cheese, half of the mozzarella (1/2 cup), half of the Parmesan (1/4 cup), cooked spinach and onions, Italian seasoning, salt, and black pepper until well combined.
  6. Stuff each cooked shell with 1-2 tablespoons of the ricotta-spinach filling. Set aside.
  7. Spread 1 cup of tomato sauce evenly on the bottom of the large pot.
  8. Arrange stuffed shells in a single layer over the sauce.
  9. Gently pour 2 1/2 cups water over the shells without displacing them. Drizzle the remaining 1 cup tomato sauce evenly on top.
  10. Cover the pot with a lid and bring to a simmer over medium heat.
  11. Simmer gently for 25 minutes until shells are tender and filling is heated through.
  12. Remove lid and sprinkle remaining mozzarella (1/2 cup) and Parmesan (1/4 cup) over shells.
  13. Cover and cook for 5 more minutes until cheese melts and bubbles.
  14. Let the dish rest off heat for 5 minutes before serving. Serve with warmed extra tomato sauce if desired.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize this one-pot vegetarian pasta recipe with these ingredient swaps for dietary needs or ingredient availability:

  • Ricotta cheese: Replace with vegan ricotta made from cashews or tofu; cottage cheese is a lighter option but alters texture.
  • Spinach: Substitute kale, Swiss chard, or thawed frozen spinach for freshness and variety.
  • Mozzarella and Parmesan cheeses: Use nutritional yeast or vegan shredded cheese alternatives for dairy-free versions.
  • Jumbo pasta shells: Try large manicotti tubes or big rigatoni if shells are unavailable.
  • Tomato sauce: Swap store-bought for homemade marinara or reduced-sodium sauces to control flavor and salt.
  • Olive oil: Mild vegetable or avocado oils work as alternatives.

These substitutions help keep the meal easy, family-friendly, high-protein, and adaptable to vegetarian, vegan, or dairy-free diets without compromising flavor or simplicity.

Pan Or Pot Required

Prepare this One-Pot Spinach and Ricotta Stuffed Shells recipe using a large, heavy-bottomed pot with a fitted lid. A Dutch oven or a wide, deep saucepan works best, allowing you to cook the jumbo pasta shells and then assemble and simmer the dish all in the same pot.

This one-pot cookware method perfectly fits the One-Pot Pasta category, making cleanup easy and cooking efficient. Ensure the pot is large enough to hold a single layer of jumbo shells to promote even cooking and avoid overcrowding. The lid is essential for gentle simmering that melts cheese and melds flavors beautifully.

Choosing the right pot ensures a quick, family-friendly, and comforting vegetarian meal that's high in protein and perfect for weeknights. Using just one pot reduces prep and cleanup time so you can enjoy more time at the table.

Cookware Size Guidance

To serve 6 people, use a pot with a minimum capacity of 5 to 6 quarts (about 5 to 6 liters). This size comfortably fits the jumbo shells, filling, tomato sauce, and water required for simmering.

A wide pot with tall sides promotes even heat distribution and keeps liquids contained during simmering. A tight-fitting lid is crucial to retain moisture, ensuring tender pasta and melted cheese.

A pot smaller than 5 quarts may overcrowd the shells, leading to uneven cooking, while a significantly larger pot may cause evaporation and longer cook times. Choosing cookware with the right size supports perfectly cooked, creamy One-Pot Spinach and Ricotta Stuffed Shells every time.

Cookware Swap Guidance

This recipe highlights simplicity as a one-pot pasta dish using a large pot with a lid, but if you don't have one, these alternatives work while maintaining ease and cleanup:

  • Deep sauté pan or large covered skillet: Should be deep enough to hold water and arranged shells in a single layer, with a lid to trap steam.
  • Wide saucepan with lid: Ensures shells cook evenly without overcrowding.
  • Ovenproof casserole or baking dish covered with foil: Pre-cook shells, assemble layers of sauce, filling, and cheese, then bake at 375°F until heated through and bubbly.
  • Slow cooker: Layer the sauce and stuffed shells, cook on low 2-3 hours for a set-and-forget option transforming it into slowcooker-friendly comfort food.

Avoid shallow pans like sheet pans, as they cannot hold enough liquid for simmering and melting cheese properly. These swaps keep the recipe easy, onepot, and family-friendly while adapting to your available cookware.

Leftovers Quality

Leftover One-Pot Spinach and Ricotta Stuffed Shells store well and make an excellent meal prep option. Refrigerate leftovers in airtight containers for 3-4 days to preserve flavor and texture.

Storage Tips: Cool completely before refrigerating. For longer storage, keep extra tomato sauce separate to prevent the shells from becoming too soft. Label containers with dates.

Reheating: Gently reheat to maintain creaminess. Microwave covered for 1-2 minute intervals, stirring between, or warm on stovetop over low heat with a splash of water or extra sauce to prevent drying.

While some ingredients freeze well, the best texture comes from freezing filling separately and cooking fresh pasta shells when possible. This recipe makes convenient, tasty leftovers perfect for busy families.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.