Cooking Techniques
PanPotPlates
Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake
By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 17, 2026 · Updated May 11, 2026
Middle Eastern-Inspired
50 mins
sheetpanonepaneasyhealthyfamily-friendlyglutenfreedairyfreeflavorfulbudget-friendlyweeknightmealprepfamilydinner
Discover an easy, flavorful Middle Eastern-inspired sheet pan dinner with za’atar-spiced chicken thighs and a vibrant mix of roasted seasonal vegetables. This healthy, gluten- and dairy-free sheet pan meal is ideal for family dinners, weeknight cooking, and meal prep.
Prep
15 min
Cook
35 min
Total
50 min
Servings
4
Difficulty
easy
Cuisine
Middle Eastern-Inspired
Ingredients
Servings
4
- 8 bone-in, skin-on chicken thighs
- 3 tablespoons olive oil, divided
- 2 tablespoons za’atar spice blend
- 1 teaspoon kosher salt
- 1/2 teaspoon freshly ground black pepper
- 1 large red bell pepper, chopped into 1-inch pieces
- 1 medium red onion, peeled and cut into wedges
- 1 medium zucchini, sliced into half-moons
- 1 cup cherry tomatoes
- 1 cup baby carrots
- 3 cloves garlic, minced
- 1 lemon, thinly sliced
- Fresh parsley, chopped (for garnish)
Instructions
-
Preheat oven to 425°F (220°C). Line a large rimmed sheet pan with parchment paper or lightly grease it with olive oil for easy cleanup and to prevent sticking.
-
In a large bowl, combine 2 tablespoons olive oil, za’atar spice blend, kosher salt, and freshly ground black pepper. Add chicken thighs and toss until evenly coated with the spice blend.
-
Place the chicken thighs skin-side up on one half of the prepared sheet pan, ensuring they are spaced apart for even roasting.
-
In the same bowl, toss chopped red bell pepper, red onion wedges, zucchini slices, cherry tomatoes, baby carrots, and minced garlic with the remaining 1 tablespoon olive oil, salt, and pepper.
-
Spread the vegetables evenly on the other half of the sheet pan. Distribute lemon slices over both the chicken and vegetables.
-
Roast in the preheated oven for 30 to 35 minutes, or until the chicken reaches an internal temperature of 165°F (74°C) and the vegetables are tender and lightly caramelized.
-
Optional: For extra crispy chicken skin, broil the traybake for 2-3 minutes at the end, watching carefully to avoid burning.
-
Remove from the oven and let rest for 5 minutes. Garnish with freshly chopped parsley before serving.
-
Serve directly from the sheet pan for easy cleanup. This dish pairs beautifully with warm pita bread or a simple tahini drizzle.
Frequently Asked Questions
Reader questions and answers for this recipe will appear here.
Customize this easy and healthy sheet pan dinner to fit your dietary preferences and pantry stock with these ingredient substitution ideas:
- Chicken Thighs: Substitute with boneless, skinless chicken breasts for a leaner protein or chicken drumsticks for a cost-effective option.
- Za’atar Spice Blend: If you can’t find za’atar, create a mix using dried thyme, oregano, sesame seeds, and sumac for an authentic flavor profile.
- Vegetables: Swap in seasonal vegetables like eggplant, assorted sweet bell peppers, or sweet potatoes for variety and budget savings.
- Olive Oil: Use avocado oil or melted coconut oil as alternatives to diversify your healthy fat sources.
- Vegan Version: Omit chicken and double the variety of vegetables; add chickpeas or baked tofu cubes for plant-based protein.
- Gluten- & Dairy-Free: This recipe is naturally gluten- and dairy-free—just ensure pre-mixed spices don’t contain gluten or dairy additives.
These swaps keep the recipe simple, flavorful, and aligned with family-friendly weeknight cooking or meal prep goals.
Pan Or Pot Required
This Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake is crafted as a classic Sheet Pan Dinner, using one large rimmed sheet pan to roast both tender chicken thighs and a medley of colorful vegetables together. This method locks in flavors while simplifying cooking and cleanup.
Use a heavy-duty sheet pan lined with parchment paper or lightly greased with olive oil to prevent sticking and make cleanup effortless.
Since this is a one-pan meal, no additional pots or pans are necessary, making it ideal for busy weeknights, meal prepping, or family-friendly dinners.
Ensure your sheet pan is large enough to arrange chicken and vegetables in a single layer with space between pieces to maximize caramelization and crispness.
Serving directly from the pan enhances the casual, easygoing feel while minimizing cleanup, perfectly aligning with the PanPotPlates philosophy of simple, delicious meals.
Cookware Size Guidance
For optimal results with this Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake, use a standard half-sheet pan approximately 18 x 13 inches (46 x 33 cm). This size offers enough space to arrange 8 bone-in, skin-on chicken thighs alongside a colorful assortment of vegetables without overcrowding.
Space between ingredients is key to achieving perfectly roasted chicken skin and evenly caramelized vegetables.
If cooking for fewer servings, a smaller quarter-sheet pan (~9 x 13 inches) works but avoid crowding to maintain texture and flavor. For larger batches or doubling the recipe, use a full sheet pan or split ingredients across two half-sheet pans.
Always line your pan with parchment paper or grease lightly for easy cleanup and to prevent sticking.
Cookware Swap Guidance
This Sheet Pan Dinner emphasizes simplicity and minimal cleanup by roasting chicken and vegetables together on a single baking sheet. If you don’t have a sheet pan, here are some suitable alternatives that preserve the recipe’s convenience and cooking style:
- Roasting Pan or Oven-Safe Baking Dish: Use a large roasting pan or oven-safe ceramic or glass dish with low sides; arrange ingredients in a single layer for roasting.
- Casserole Dish: Good for space and moisture retention, though vegetables may steam slightly rather than roast crisp.
- Large Cast Iron Skillet: Oven-safe and perfect for browning chicken; ensure enough room to roast vegetables evenly.
- Half Sheet Pan or Jelly Roll Pan: If a full sheet pan is unavailable, these are excellent substitutes; adjust spacing and cooking times if needed.
Avoid deep pots or pans as they limit airflow and inhibit proper roasting and caramelization. If alternatives aren’t available, consider roasting chicken and vegetables separately using appropriate cookware.
These options maintain the recipe’s ease, speedy preparation, and family-friendly appeal while keeping the signature bold flavors and textures.
Leftovers Quality
This sheet pan za’atar chicken and roasted vegetable traybake stores exceptionally well, making it a smart choice for meal prep or quick reheats on busy days. After cooking, cool leftovers promptly and store in airtight containers in the refrigerator within two hours for best quality.
Properly refrigerated leftovers stay fresh for up to 3-4 days.
To reheat, warm gently in the oven at 350°F (175°C) for 10-15 minutes or microwave covered with a damp paper towel for 1-2 minutes, stirring midway to retain moisture and prevent drying out.
Avoid reheating multiple times to maintain taste and safety.
For longer storage, freeze leftovers tightly wrapped or vacuum-sealed for up to 2-3 months. Thaw overnight in the refrigerator before reheating.
These storage and reheating tips help you enjoy this budget-friendly, family-friendly sheet pan meal anytime with minimal effort.
Related Articles
Read related air fryer guides and cooking tips.
More Recipes
Explore more recipes you may like.
Sheet Pan Dinners
Sheet Pan Spiced Lamb Kofta with Cumin Roasted Carrots
Sheet Pan Dinners
Sheet Pan Spiced Chickpea and Cauliflower Shawarma
Sheet Pan Dinners
Sheet Pan Roasted Chickpea and Butternut Squash with Tahini Drizzle
Sheet Pan Dinners
Sheet Pan Roasted Cauliflower Steaks with Romesco Sauce
Reviews
Rate this recipe and share a photo of your result.
No reviews yet.
Save this recipe
Log in to keep this recipe in your favorites.
Reset password Register