PanPotPlates

Sheet Pan Dinners

Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake

By PanPotPlates Editorial TeamPublished Apr 17, 2026 | Updated May 11, 2026
Middle Eastern-Inspired 50 mins sheetpanonepaneasyhealthyfamily-friendlyglutenfreedairyfreeflavorfulbudget-friendlyweeknightmealprepfamilydinner

Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake is a practical PanPotPlates recipe built for dependable weeknight cooking.

Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake
Prep 15 min
Cook 35 min
Total 50 min
Servings 4
Difficulty easy
Cuisine Middle Eastern-Inspired

Recipe Details

Prep15 min
Cook35 min
Total50 min
Servings4
Difficultyeasy
CuisineMiddle Eastern-Inspired
Add To Favorites

Ingredients

Servings 4
  • 8 bone-in, skin-on chicken thighs
  • 3 tablespoons olive oil, divided
  • 2 tablespoons za’atar spice blend
  • 1 teaspoon kosher salt
  • 1/2 teaspoon freshly ground black pepper
  • 1 large red bell pepper, chopped into 1-inch pieces
  • 1 medium red onion, peeled and cut into wedges
  • 1 medium zucchini, sliced into half-moons
  • 1 cup cherry tomatoes
  • 1 cup baby carrots
  • 3 cloves garlic, minced
  • 1 lemon, thinly sliced
  • Fresh parsley, chopped (for garnish)
Ingredients for Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake
Ingredients for Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake

Instructions

  1. Preheat oven to 425°F (220°C). Line a large rimmed sheet pan with parchment paper or lightly grease it with olive oil for easy cleanup and to prevent sticking.
  2. In a large bowl, combine 2 tablespoons olive oil, za’atar spice blend, kosher salt, and freshly ground black pepper. Add chicken thighs and toss until evenly coated with the spice blend.
  3. Place the chicken thighs skin-side up on one half of the prepared sheet pan, ensuring they are spaced apart for even roasting.
  4. In the same bowl, toss chopped red bell pepper, red onion wedges, zucchini slices, cherry tomatoes, baby carrots, and minced garlic with the remaining 1 tablespoon olive oil, salt, and pepper.
  5. Spread the vegetables evenly on the other half of the sheet pan. Distribute lemon slices over both the chicken and vegetables.
  6. Roast in the preheated oven for 30 to 35 minutes, or until the chicken reaches an internal temperature of 165°F (74°C) and the vegetables are tender and lightly caramelized.
  7. Optional: For extra crispy chicken skin, broil the traybake for 2-3 minutes at the end, watching carefully to avoid burning.
  8. Remove from the oven and let rest for 5 minutes. Garnish with freshly chopped parsley before serving.
  9. Serve directly from the sheet pan for easy cleanup. This dish pairs beautifully with warm pita bread or a simple tahini drizzle.
Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake cooking in the recommended pan or pot
Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake is crafted as a classic Sheet Pan Dinner , using one large rimmed sheet pan to roast both tender chicken thighs and a medley of colorful vegetables together.

Cookware Size Guidance

For optimal results with this Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake , use a standard half-sheet pan approximately 18 x 13 inches (46 x 33 cm).

Cookware Swap Guidance

This Sheet Pan Dinner emphasizes simplicity and minimal cleanup by roasting chicken and vegetables together on a single baking sheet.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a rimmed sheet pan and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this easy and healthy sheet pan dinner to fit your dietary preferences and pantry stock with these ingredient substitution ideas:

  • Chicken Thighs: Substitute with boneless, skinless chicken breasts for a leaner protein or chicken drumsticks for a cost-effective option.
  • Za’atar Spice Blend: If you can’t find za’atar, create a mix using dried thyme, oregano, sesame seeds, and sumac for an authentic flavor profile.
  • Vegetables: Swap in seasonal vegetables like eggplant, assorted sweet bell peppers, or sweet potatoes for variety and budget savings.
  • Olive Oil: Use avocado oil or melted coconut oil as alternatives to diversify your healthy fat sources.
  • Vegan Version: Omit chicken and double the variety of vegetables; add chickpeas or baked tofu cubes for plant-based protein.
  • Gluten- & Dairy-Free: This recipe is naturally gluten- and dairy-free—just ensure pre-mixed spices don’t contain gluten or dairy additives.

Storage and Reheating

Cool Sheet Pan Za’atar Chicken and Roasted Vegetable Traybake before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.