What cookware works best?

Use a wide skillet and avoid crowding so the recipe cooks evenly.

How do I know it is done?

Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.

Can I adjust the seasoning?

Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Back to Recipes

Skillet Meals

Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice

Name: Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice
Prep time: 10 min
Cook time: 18 min
Total time: 28 min
Yield: 4 servings
Cuisine: Mexican-Inspired
Ingredients: 1.5 lbs boneless, skinless chicken breasts, thinly sliced; 1 tablespoon olive oil; 1 teaspoon chili powder; 1/2 teaspoon smoked paprika; 1/2 teaspoon ground cumin; 1/4 teaspoon cayenne pepper (adjust to taste); Salt and black pepper, to taste; 3 cloves garlic, minced; 1 small onion, diced; 1 medium red bell pepper, diced; 4 cups cauliflower rice (fresh or frozen); 1/2 cup fresh cilantro, chopped; Juice and zest of 1 lime; 1/4 cup low-sodium chicken broth or water; sliced avocado, extra cilantro leaves, lime wedges

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished May 5, 2026

Mexican-Inspired 28 mins onepanskilletlowcarbquickeasyhealthyfamily-friendlyhighproteinflavorfultimessaverkid-friendly

A vibrant, healthy, one-pan Mexican-inspired skillet meal featuring juicy, spicy chicken with zesty cilantro lime cauliflower rice. Ready in under 30 minutes, this easy, low-carb, high-protein dinner is perfect for busy weeknights and family-friendly meals.

Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice

Prep 10 min

Cook 18 min

Total 28 min

Servings 4

Difficulty easy

Cuisine Mexican-Inspired

Ingredients

Servings 4

1.5 lbs boneless, skinless chicken breasts, thinly sliced
1 tablespoon olive oil
1 teaspoon chili powder
1/2 teaspoon smoked paprika
1/2 teaspoon ground cumin
1/4 teaspoon cayenne pepper (adjust to taste)
Salt and black pepper, to taste
3 cloves garlic, minced
1 small onion, diced
1 medium red bell pepper, diced
4 cups cauliflower rice (fresh or frozen)
1/2 cup fresh cilantro, chopped
Juice and zest of 1 lime
1/4 cup low-sodium chicken broth or water
sliced avocado, extra cilantro leaves, lime wedges

Ingredients for Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice

Instructions

In a medium bowl, combine chili powder, smoked paprika, cumin, cayenne, salt, and black pepper. Add the sliced chicken and toss to coat evenly.
Heat olive oil over medium-high heat in a large non-stick skillet.
Add the seasoned chicken to the skillet and cook for 4-5 minutes, stirring occasionally, until browned and cooked through. Remove chicken from skillet and set aside.
In the same skillet, add diced onion, red bell pepper, and minced garlic. Sauté for 3-4 minutes until softened and fragrant.
Add the cauliflower rice to the skillet along with chicken broth or water. Stir to combine, then cover and cook for 5 minutes until cauliflower is tender but not mushy.
Return the cooked chicken to the skillet and stir in chopped cilantro, lime juice, and lime zest. Mix everything until well combined and heated through. Adjust seasoning with salt and pepper as needed.
Remove from heat and serve immediately. Top with optional avocado slices, extra cilantro, and lime wedges if desired.

Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is designed as a one-pan skillet meal , making it incredibly convenient for quick, healthy weeknight dinners.

Cookware Size Guidance

For the best results with this flavorful Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice , we recommend a 12-inch (30 cm) non-stick skillet with at least 3 to 4 quarts capacity.

Cookware Swap Guidance

This recipe shines as a skillet meal made in a large non-stick skillet, delivering quick, easy, and family-friendly results.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice ahead?: Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?: Use a wide skillet and avoid crowding so the recipe cooks evenly.
How do I know it is done?: Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?: Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

If you’d like to customize this one-pan skillet meal to meet dietary preferences or ingredient availability, consider these substitutions that keep it quick, healthy, and full of flavor:

Chicken breasts: Use boneless, skinless chicken thighs for richer taste or swap for firm tofu or tempeh to make it vegan and plant-based.
Olive oil: Substitute with avocado oil or coconut oil based on your flavor preference and dietary needs.
Spices (chili powder, smoked paprika, cumin, cayenne): A pre-made taco or fajita seasoning blend offers convenience; reduce cayenne to lower heat for kids.
Cauliflower rice: Swap with finely chopped broccoli or shredded zucchini for a different yet nutritious veggie base.
Chicken broth: Use vegetable broth or water with a splash of soy sauce or tamari for vegetarian versions and umami boost.
Cilantro and lime: Substitute fresh parsley with lemon zest and juice if cilantro or limes aren’t available.
Optional toppings: Replace avocado slices with sliced olives or a dollop of dairy-free yogurt to add creaminess.

These swaps maintain the dish’s flavorful, healthy, family-friendly, and low-carb appeal while allowing flexibility for diverse diets and pantry staples.

Storage and Reheating

Cool Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice

Recipe Details

Ingredients

Instructions