PanPotPlates
Back to Recipes

Skillet Meals

Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished May 5, 2026
Mexican-Inspired 28 mins onepanskilletlowcarbquickeasyhealthyfamily-friendlyhighproteinflavorfultimessaverkid-friendly

A vibrant, healthy, one-pan Mexican-inspired skillet meal featuring juicy, spicy chicken with zesty cilantro lime cauliflower rice. Ready in under 30 minutes, this easy, low-carb, high-protein dinner is perfect for busy weeknights and family-friendly meals.

Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice
Prep 10 min
Cook 18 min
Total 28 min
Servings 4
Difficulty easy
Cuisine Mexican-Inspired

Recipe Details

Prep10 min
Cook18 min
Total28 min
Servings4
Difficultyeasy
CuisineMexican-Inspired
Add To Favorites

Ingredients

Servings 4
  • 1.5 lbs boneless, skinless chicken breasts, thinly sliced
  • 1 tablespoon olive oil
  • 1 teaspoon chili powder
  • 1/2 teaspoon smoked paprika
  • 1/2 teaspoon ground cumin
  • 1/4 teaspoon cayenne pepper (adjust to taste)
  • Salt and black pepper, to taste
  • 3 cloves garlic, minced
  • 1 small onion, diced
  • 1 medium red bell pepper, diced
  • 4 cups cauliflower rice (fresh or frozen)
  • 1/2 cup fresh cilantro, chopped
  • Juice and zest of 1 lime
  • 1/4 cup low-sodium chicken broth or water
  • sliced avocado, extra cilantro leaves, lime wedges

Instructions

  1. In a medium bowl, combine chili powder, smoked paprika, cumin, cayenne, salt, and black pepper. Add the sliced chicken and toss to coat evenly.
  2. Heat olive oil over medium-high heat in a large non-stick skillet.
  3. Add the seasoned chicken to the skillet and cook for 4-5 minutes, stirring occasionally, until browned and cooked through. Remove chicken from skillet and set aside.
  4. In the same skillet, add diced onion, red bell pepper, and minced garlic. Sauté for 3-4 minutes until softened and fragrant.
  5. Add the cauliflower rice to the skillet along with chicken broth or water. Stir to combine, then cover and cook for 5 minutes until cauliflower is tender but not mushy.
  6. Return the cooked chicken to the skillet and stir in chopped cilantro, lime juice, and lime zest. Mix everything until well combined and heated through. Adjust seasoning with salt and pepper as needed.
  7. Remove from heat and serve immediately. Top with optional avocado slices, extra cilantro, and lime wedges if desired.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

If you’d like to customize this one-pan skillet meal to meet dietary preferences or ingredient availability, consider these substitutions that keep it quick, healthy, and full of flavor:

  • Chicken breasts: Use boneless, skinless chicken thighs for richer taste or swap for firm tofu or tempeh to make it vegan and plant-based.
  • Olive oil: Substitute with avocado oil or coconut oil based on your flavor preference and dietary needs.
  • Spices (chili powder, smoked paprika, cumin, cayenne): A pre-made taco or fajita seasoning blend offers convenience; reduce cayenne to lower heat for kids.
  • Cauliflower rice: Swap with finely chopped broccoli or shredded zucchini for a different yet nutritious veggie base.
  • Chicken broth: Use vegetable broth or water with a splash of soy sauce or tamari for vegetarian versions and umami boost.
  • Cilantro and lime: Substitute fresh parsley with lemon zest and juice if cilantro or limes aren’t available.
  • Optional toppings: Replace avocado slices with sliced olives or a dollop of dairy-free yogurt to add creaminess.

These swaps maintain the dish’s flavorful, healthy, family-friendly, and low-carb appeal while allowing flexibility for diverse diets and pantry staples.

Pan Or Pot Required

This recipe is designed as a one-pan skillet meal, making it incredibly convenient for quick, healthy weeknight dinners. You'll need a large non-stick skillet or a well-seasoned cast iron skillet to achieve the perfect sear on the chicken and cook the cilantro lime cauliflower rice evenly without sticking or burning.

The skillet must be large enough to comfortably hold all the ingredients with space to stir and combine the vibrant Mexican-inspired flavors effectively. Opt for a pan with a lid or one that can be covered with foil, as steaming the cauliflower rice covered during cooking retains moisture and ensures tenderness.

This method supports quick, flavorful cooking while minimizing cleanup, aligning well with the recipe’s tags such as onepan, quick, easy, healthy, and family-friendly. Avoid using pots, slow cookers, or baking dishes for this recipe to maintain the ideal texture and fresh zestiness of the cilantro lime chicken and cauliflower rice.

Cookware Size Guidance

For the best results with this flavorful Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice, we recommend a 12-inch (30 cm) non-stick skillet with at least 3 to 4 quarts capacity. This size allows you to properly brown the chicken slices without overcrowding, which is key for even cooking and developing a delicious sear.

The skillet should also be large enough to hold sautéed vegetables and cauliflower rice comfortably without spilling when stirring. Using a pan smaller than 10 inches can cause steaming rather than sautéing, diminishing the flavor and texture.

If you don't have a 12-inch skillet, a similar-sized sauté pan or cast iron skillet works well. This cookware size matches the 4-serving quantity and enhances the one-pan cooking style, making cleanup fast and easy — perfect for busy, family-friendly weeknights.

Cookware Swap Guidance

This recipe shines as a skillet meal made in a large non-stick skillet, delivering quick, easy, and family-friendly results. If a skillet isn’t available, these are excellent alternatives that keep the healthy, low-carb, and high-protein qualities intact:

  • Heavy-Bottomed Sauté Pan or Frying Pan: Similar heat distribution and searing capacity make them ideal substitutes for browning chicken and sautéing vegetables without sacrificing flavor.
  • Oven-Safe Casserole Dish: Brown chicken and vegetables stovetop, then transfer to the casserole for oven finishing with a lid to keep cauliflower rice tender while maintaining one-pot convenience.
  • Instant Pot (Sauté Mode): Use sauté to brown chicken and veggies, then simmer cauliflower rice with broth under pressure for a quick, flavorful one-pot Mexican-inspired meal. This method suits instantpot and onepot tags, saving time.
  • Electric Non-Stick Skillet: A perfect option if stove access is limited, enabling one-pan cooking and precise temperature control for quick, healthy meals.

Avoid deep pots or stockpots with narrow surfaces as they tend to steam rather than sear, reducing flavor and texture quality. Choose cookware with a wide, flat surface and excellent heat conduction for best results, ensuring your one-pan chicken skillet dinner remains flavorful, quick, and family-friendly.

Leftovers Quality

This Skillet Spicy Cilantro Lime Chicken with Cauliflower Rice stays fresh for 3-4 days refrigerated when stored in airtight containers. For maintaining tender textures and vibrant flavors, cool leftovers to room temperature before sealing.

Storing in single-portion containers makes reheating effortless and helps preserve quality. Reheat gently in a skillet over medium-low heat, stirring occasionally, or microwave covered for 1-2 minutes, stirring halfway through for even warmth. To refresh flavors, add a squeeze of fresh lime juice and a sprinkle of chopped cilantro after reheating.

While it can be frozen, best texture is retained when enjoyed refrigerated within a few days. This makes it ideal for meal prepping healthy, low-carb, high-protein dinners that remain flavorful without sogginess—a common challenge for skillet meals.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

Sign In To Review

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.