PanPotPlates

Instant Pot Recipes

Instant Pot Creamy Mushroom and Spinach Risotto

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 12, 2026 · Updated May 11, 2026
Italian-Inspired 30 mins instantpotonepoteasyvegetarianfamily-friendlyquickcomfortfoodhighproteintimessaver

Savor this creamy, delicious, and easy-to-make mushroom and spinach risotto prepared effortlessly in your Instant Pot. A vegetarian, protein-packed, and comforting Italian-inspired dish, perfect for family dinners or quick weeknight meals.

Instant Pot Creamy Mushroom and Spinach Risotto
Prep 10 min
Cook 20 min
Total 30 min
Servings 4
Difficulty easy
Cuisine Italian-Inspired

Recipe Details

Prep10 min
Cook20 min
Total30 min
Servings4
Difficultyeasy
CuisineItalian-Inspired
Add To Favorites

Ingredients

Servings 4
  • 2 teaspoons olive oil
  • 1 small onion, finely chopped
  • 3 cloves garlic, minced
  • 8 ounces cremini or white mushrooms, sliced
  • 1 cup Arborio rice
  • 1/2 cup dry white wine (optional)
  • 3 cups vegetable broth, warmed
  • 3 cups fresh baby spinach, roughly chopped
  • 1/2 cup grated Parmesan cheese
  • 1/4 cup part-skim ricotta cheese
  • Salt and freshly ground black pepper, to taste
  • 1/4 teaspoon dried thyme
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • Fresh parsley, chopped (for garnish)

Instructions

  1. Set your Instant Pot to 'Sauté' mode and heat the olive oil.
  2. Add the chopped onion and sauté until softened and translucent, about 3 minutes.
  3. Stir in the minced garlic and cook for 30 seconds until fragrant.
  4. Add the sliced mushrooms and cook, stirring occasionally, until they release their liquid and become tender, about 5 minutes.
  5. Stir in the Arborio rice, coating it well with the mushroom and onion mixture. Toast the rice for 1-2 minutes to enhance flavor.
  6. Pour in the white wine, if using, and cook for 1-2 minutes until mostly absorbed.
  7. Add the warmed vegetable broth, dried thyme, and red pepper flakes (if using). Stir well, scraping any bits off the bottom of the pot.
  8. Close the Instant Pot lid and set the valve to sealing. Select 'Pressure Cook' or 'Manual' mode and cook on high pressure for 6 minutes.
  9. When cooking finishes, carefully perform a quick pressure release by turning the valve to venting.
  10. Open the lid and stir in the chopped spinach until wilted.
  11. Mix in the Parmesan cheese and ricotta until the risotto is creamy. Season with salt and pepper to taste.
  12. Serve immediately, garnished with chopped fresh parsley.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize this Instant Pot Creamy Mushroom and Spinach Risotto to suit your dietary needs or ingredient availability without sacrificing its creamy texture, comforting taste, or quick and easy family-friendly nature:

  • Mushrooms: Replace cremini or white mushrooms with shiitake, portobello, or oyster mushrooms for varied earthy flavor profiles.
  • Arborio Rice: For a lower-carb version, use cauliflower rice—but shorten cooking time and add spinach earlier since cauliflower cooks faster than rice.
  • White Wine: Omit alcohol and substitute with extra vegetable broth plus a splash of lemon juice for brightness.
  • Vegetable Broth: Replace with chicken broth if not strictly vegetarian, for added savory depth.
  • Parmesan Cheese: Swap Parmesan with nutritional yeast or vegan Parmesan alternatives for dairy-free or vegan options.
  • Ricotta Cheese: Use plant-based ricotta or blend silken tofu with lemon juice and nutritional yeast for creamy, dairy-free substitutes.
  • Spinach: Substitute kale or Swiss chard for a seasonal variation; sauté slightly longer until tender.
  • Olive Oil: Use avocado oil or mild cooking oils to alter flavor or create a lighter dish.

These ingredient swaps keep this comforting, high-protein vegetarian risotto flexible, making it an ideal quick meal for family dinners or meal prep plans.

Pan Or Pot Required

This recipe is specifically crafted for an Instant Pot, aligning perfectly with the Instant Pot Recipes category on PanPotPlates. Utilizing the Instant Pot lets you create this creamy mushroom and spinach risotto in one pot, making it a convenient, time-saving option especially suited for quick, family-friendly weeknight dinners.

The Instant Pot functions as both a sauté pan and pressure cooker, eliminating the need for multiple cookware pieces. This one-pot method simplifies cleanup and streamlines the cooking process. Using the Instant Pot’s sauté feature softens onions and mushrooms and toasts the rice before pressure cooking, building deep, layered flavors without changing pots.

For optimal results, cook in the Instant Pot’s standard stainless steel inner pot, which ensures even heat distribution and efficient pressure cooking. Avoid alternate inserts or non-stick liners as they may interfere with pressure cooking performance.

In summary, the only required cookware is your Instant Pot with its standard stainless steel inner pot. This single-pot approach reduces dishwashers and saves time, allowing you to enjoy a wholesome meal with minimal effort and maximum flavor.

Cookware Size Guidance

Use a standard 6-quart (5.7 L) Instant Pot or electric pressure cooker for best results with this creamy mushroom and spinach risotto recipe. This size offers sufficient capacity to hold all the ingredients—rice, broth, vegetables, and cheese—while allowing enough space for proper pressure cooking and stirring without spills.

Smaller 3-quart models may be too compact to safely prepare this dish, while larger 8-quart or bigger devices can work; however, you may need to adjust liquid quantities or cooking times slightly to prevent overcooking or drying out the risotto.

Choosing a 6-quart Instant Pot ensures consistent heat distribution and optimal pressure buildup, yielding perfectly creamy, evenly cooked risotto every time. Following this guideline supports hassle-free one-pot meals and quick cleanup.

Cookware Swap Guidance

This recipe delivers excellent results when made in an Instant Pot, thanks to its combined sautéing and pressure cooking functions that produce creamy, perfectly textured risotto quickly and easily. If you don’t own an Instant Pot, consider these alternate cookware options that maintain the Instant Pot Recipes spirit along with tags like onepot, easy, and family-friendly:

  • Stovetop Pressure Cooker: Use a stovetop pressure cooker to mimic the Instant Pot’s high-pressure environment. Follow the sauté steps on the stovetop, then pressure cook as per your device’s instructions, adjusting times as necessary.
  • Heavy-Bottomed Pot or Dutch Oven: Make the risotto entirely on the stovetop by sautéing the vegetables and slowly adding warm broth while stirring often. Though more hands-on, this method yields deliciously creamy risotto.
    Ideal for onepot, family-friendly, and comfortfood needs.
  • Slow Cooker: While less common for risotto, you can adapt by sautéing ingredients first, then transferring to the slow cooker. Cook on high for 2-3 hours, stirring occasionally to blend flavors and tenderize the rice.

Each alternative keeps this recipe accessible while preserving its quick, comforting, and family-friendly qualities—allowing you to enjoy creamy mushroom and spinach risotto anytime.

Leftovers Quality

This Instant Pot Creamy Mushroom and Spinach Risotto stores well for up to 3 days in an airtight container refrigerated, making it perfect for meal prep or easy reheating on busy days. The creamy texture and rich flavor hold up nicely when stored properly.

Allow the risotto to cool before refrigeration. Reheat gently in a skillet over medium-low heat or microwave, stirring occasionally. Add a splash of vegetable broth or water to loosen the risotto as it tends to thicken upon chilling. Avoid overheating to maintain the tender texture of the spinach and risotto.

Freezing is also an option: place cooled risotto in a freezer-safe container and consume within 1 month for best quality. Thaw overnight in the fridge and reheat gently as described above.

This one-pot Instant Pot dish not only saves time on cooking day but also helps reduce food waste by storing and reheating beautifully, ensuring flavorful and hassle-free weeknight dinners.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.