PanPotPlates

Instant Pot Recipes

Instant Pot Creamy Mushroom and Spinach Risotto

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 12, 2026 · Updated May 11, 2026
Italian-Inspired 30 mins instantpotonepoteasyvegetarianfamily-friendlyquickcomfortfoodhighproteintimessaver

Savor this creamy, delicious, and easy-to-make mushroom and spinach risotto prepared effortlessly in your Instant Pot. A vegetarian, protein-packed, and comforting Italian-inspired dish, perfect for family dinners or quick weeknight meals.

Instant Pot Creamy Mushroom and Spinach Risotto
Prep 10 min
Cook 20 min
Total 30 min
Servings 4
Difficulty easy
Cuisine Italian-Inspired

Recipe Details

Prep10 min
Cook20 min
Total30 min
Servings4
Difficultyeasy
CuisineItalian-Inspired
Add To Favorites

Ingredients

Servings 4
  • 2 teaspoons olive oil
  • 1 small onion, finely chopped
  • 3 cloves garlic, minced
  • 8 ounces cremini or white mushrooms, sliced
  • 1 cup Arborio rice
  • 1/2 cup dry white wine (optional)
  • 3 cups vegetable broth, warmed
  • 3 cups fresh baby spinach, roughly chopped
  • 1/2 cup grated Parmesan cheese
  • 1/4 cup part-skim ricotta cheese
  • Salt and freshly ground black pepper, to taste
  • 1/4 teaspoon dried thyme
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • Fresh parsley, chopped (for garnish)
Ingredients for Instant Pot Creamy Mushroom and Spinach Risotto
Ingredients for Instant Pot Creamy Mushroom and Spinach Risotto

Instructions

  1. Set your Instant Pot to 'Sauté' mode and heat the olive oil.
  2. Add the chopped onion and sauté until softened and translucent, about 3 minutes.
  3. Stir in the minced garlic and cook for 30 seconds until fragrant.
  4. Add the sliced mushrooms and cook, stirring occasionally, until they release their liquid and become tender, about 5 minutes.
  5. Stir in the Arborio rice, coating it well with the mushroom and onion mixture. Toast the rice for 1-2 minutes to enhance flavor.
  6. Pour in the white wine, if using, and cook for 1-2 minutes until mostly absorbed.
  7. Add the warmed vegetable broth, dried thyme, and red pepper flakes (if using). Stir well, scraping any bits off the bottom of the pot.
  8. Close the Instant Pot lid and set the valve to sealing. Select 'Pressure Cook' or 'Manual' mode and cook on high pressure for 6 minutes.
  9. When cooking finishes, carefully perform a quick pressure release by turning the valve to venting.
  10. Open the lid and stir in the chopped spinach until wilted.
  11. Mix in the Parmesan cheese and ricotta until the risotto is creamy. Season with salt and pepper to taste.
  12. Serve immediately, garnished with chopped fresh parsley.
Instant Pot Creamy Mushroom and Spinach Risotto cooking in the recommended pan or pot
Instant Pot Creamy Mushroom and Spinach Risotto cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is specifically crafted for an Instant Pot , aligning perfectly with the Instant Pot Recipes category on PanPotPlates.

Cookware Size Guidance

Use a standard 6-quart (5.7 L) Instant Pot or electric pressure cooker for best results with this creamy mushroom and spinach risotto recipe.

Cookware Swap Guidance

This recipe delivers excellent results when made in an Instant Pot, thanks to its combined sautéing and pressure cooking functions that produce creamy, perfectly textured risotto quickly and easily.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Instant Pot Creamy Mushroom and Spinach Risotto ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a Instant Pot or electric pressure cooker and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this Instant Pot Creamy Mushroom and Spinach Risotto to suit your dietary needs or ingredient availability without sacrificing its creamy texture, comforting taste, or quick and easy family-friendly nature:

  • Mushrooms: Replace cremini or white mushrooms with shiitake, portobello, or oyster mushrooms for varied earthy flavor profiles.
  • Arborio Rice: For a lower-carb version, use cauliflower rice—but shorten cooking time and add spinach earlier since cauliflower cooks faster than rice.
  • White Wine: Omit alcohol and substitute with extra vegetable broth plus a splash of lemon juice for brightness.
  • Vegetable Broth: Replace with chicken broth if not strictly vegetarian, for added savory depth.
  • Parmesan Cheese: Swap Parmesan with nutritional yeast or vegan Parmesan alternatives for dairy-free or vegan options.
  • Ricotta Cheese: Use plant-based ricotta or blend silken tofu with lemon juice and nutritional yeast for creamy, dairy-free substitutes.
  • Spinach: Substitute kale or Swiss chard for a seasonal variation; sauté slightly longer until tender.
  • Olive Oil: Use avocado oil or mild cooking oils to alter flavor or create a lighter dish.

Storage and Reheating

Cool Instant Pot Creamy Mushroom and Spinach Risotto before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.