PanPotPlates

Instant Pot Recipes

Instant Pot Mediterranean Chickpea and Spinach Stew

By PanPotPlates Editorial TeamPublished May 1, 2026 | Updated May 12, 2026
Mediterranean-Inspired 25 mins instantpotonepotveganhealthyfamily-friendlyeasyquickglutenfreedairyfreeflavorfulbudget-friendlymealprep

Instant Pot Mediterranean Chickpea and Spinach Stew is a practical PanPotPlates recipe built for dependable weeknight cooking.

Instant Pot Mediterranean Chickpea and Spinach Stew
Prep 10 min
Cook 15 min
Total 25 min
Servings 6
Difficulty easy
Cuisine Mediterranean-Inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings6
Difficultyeasy
CuisineMediterranean-Inspired
Add To Favorites

Ingredients

Servings 6
  • 1 tablespoon olive oil
  • 1 medium onion, diced
  • 3 garlic cloves, minced
  • 1 teaspoon ground cumin
  • 1 teaspoon smoked paprika
  • 1/2 teaspoon ground coriander
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • 1 (14-ounce) can diced tomatoes
  • 1 (15-ounce) can chickpeas, drained and rinsed
  • 3 cups fresh spinach, roughly chopped
  • 2 cups vegetable broth
  • Juice of 1 lemon
  • Salt and freshly ground black pepper, to taste
  • 2 tablespoons chopped fresh parsley (for garnish)
Ingredients for Instant Pot Mediterranean Chickpea and Spinach Stew
Ingredients for Instant Pot Mediterranean Chickpea and Spinach Stew

Instructions

  1. Turn on the Instant Pot and select the 'Sauté' function. Heat the olive oil.
  2. Add the diced onion and cook, stirring frequently, until translucent, about 3-4 minutes.
  3. Stir in the minced garlic, cumin, smoked paprika, coriander, and crushed red pepper flakes if using. Sauté for about 1 minute until fragrant.
  4. Pour in the diced tomatoes, chickpeas, and vegetable broth. Stir to combine.
  5. Secure the Instant Pot lid and set the valve to 'Sealing.' Cook on 'Manual' or 'Pressure Cook' high pressure for 8 minutes.
  6. When cooking time ends, perform a quick release by carefully switching the valve to 'Venting.' Once pressure is fully released, open the lid.
  7. Stir in the chopped spinach and lemon juice until the spinach wilts, about 2 minutes.
  8. Season with salt and freshly ground black pepper to taste.
  9. Serve the stew hot, garnished with chopped fresh parsley.
  10. Leftovers can be stored in an airtight container in the refrigerator for up to 4 days or frozen for up to 3 months.
Instant Pot Mediterranean Chickpea and Spinach Stew cooking in the recommended pan or pot
Instant Pot Mediterranean Chickpea and Spinach Stew cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This Instant Pot Mediterranean Chickpea and Spinach Stew is crafted to make the most of your Instant Pot , offering a convenient one-pot cooking experience.

Cookware Size Guidance

A 6-quart Instant Pot is perfect for this recipe, comfortably accommodating 6 servings of this flavorful chickpea and spinach stew without risk of overflow.

Cookware Swap Guidance

erranean Chickpea and Spinach Stew while retaining its one-pot, vegan, gluten-free, dairy-free, and healthy credentials: Slow Cooker: Sauté onions and spices in a skillet first, then transfer ingredients to a slow cooker.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Instant Pot Mediterranean Chickpea and Spinach Stew ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a Instant Pot or electric pressure cooker and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize your Instant Pot Mediterranean Chickpea and Spinach Stew easily by swapping ingredients while keeping it nutritious and flavorful:

  • Chickpeas: Replace with white beans, cannellini beans, or lentils to vary texture and protein content.
  • Fresh Spinach: Kale or Swiss chard make hearty, nutrient-dense alternatives that wilt nicely.
  • Diced Tomatoes: Use fire-roasted canned tomatoes or fresh cherry tomatoes sautéed beforehand for a smoky or sweeter profile.
  • Vegetable Broth: Swap for mushroom broth or a homemade Mediterranean-spiced broth to deepen flavor complexity.
  • Olive Oil: Substitute with avocado oil or mild coconut oil depending on flavor or dietary needs.
  • Spices: Use regular paprika or chipotle powder if smoked paprika is unavailable; adjust crushed red pepper flakes to suit your heat preference.
  • Lemon Juice: Replace with fresh lime juice or a splash of red wine or apple cider vinegar to maintain bright acidity.

Storage and Reheating

Cool Instant Pot Mediterranean Chickpea and Spinach Stew before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.