PanPotPlates

One-Pot Comfort Food

One-Pot Lemon Herb Pesto Cannellini Beans and Spinach

By PanPotPlates Editorial TeamPublished May 11, 2026
Italian-Inspired 25 mins onepotvegetarianhealthyfamily-friendlyquickeasycomfortfoodglutenfreedairyfree

Enjoy a quick, healthy, and comforting one-pot meal featuring tender cannellini beans, fresh spinach, and vibrant lemon herb pesto for a flavorful Italian-inspired dinner.

One-Pot Lemon Herb Pesto Cannellini Beans and Spinach
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine Italian-Inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineItalian-Inspired
Add To Favorites

Ingredients

Servings 4
  • 2 tablespoons olive oil
  • 1 small yellow onion, finely chopped
  • 3 cloves garlic, minced
  • 1 (15-ounce) can cannellini beans, drained and rinsed
  • 4 cups fresh baby spinach
  • 1 cup vegetable broth
  • 1 tablespoon lemon zest
  • 2 tablespoons fresh lemon juice
  • 1/4 cup prepared basil pesto (store-bought or homemade, dairy-free if preferred)
  • Salt and freshly ground black pepper, to taste
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • Fresh basil leaves, for garnish
  • Toasted pine nuts, for garnish (optional)
Ingredients for One-Pot Lemon Herb Pesto Cannellini Beans and Spinach
Ingredients for One-Pot Lemon Herb Pesto Cannellini Beans and Spinach

Instructions

  1. Heat the olive oil in a large deep skillet or sauté pan over medium heat.
  2. Add the finely chopped onion and sauté for 3-4 minutes until soft and translucent.
  3. Stir in the minced garlic and cook for 30 seconds until fragrant, being careful not to burn it.
  4. Add the cannellini beans to the pan and pour in the vegetable broth. Stir to combine.
  5. Bring the mixture to a light simmer and cook for 5 minutes to allow flavors to meld.
  6. Add the fresh baby spinach, stirring until wilted and incorporated.
  7. Remove the pan from heat and stir in the lemon zest, lemon juice, and basil pesto until well coated.
  8. Season with salt, freshly ground black pepper, and crushed red pepper flakes (if using) to taste.
  9. Serve immediately, garnished with fresh basil leaves and toasted pine nuts for extra texture and flavor.
One-Pot Lemon Herb Pesto Cannellini Beans and Spinach cooking in the recommended pan or pot
One-Pot Lemon Herb Pesto Cannellini Beans and Spinach cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is crafted as a comforting One-Pot Comfort Food meal, focusing on simplicity and minimal cleanup by using a single cooking vessel.

Cookware Size Guidance

For this One-Pot Comfort Food recipe serving 4 people, use a large deep skillet or sauté pan with a capacity of about 3 to 4 quarts .

Cookware Swap Guidance

This recipe is designed as a One-Pot Comfort Food dish and is best prepared in a large deep skillet or sauté pan to allow sufficient space for stirring and even heat distribution when cooking cannellini beans and spinach.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make One-Pot Lemon Herb Pesto Cannellini Beans and Spinach ahead?
Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?
Use a heavy pot or Dutch oven and avoid crowding so the recipe cooks evenly.
How do I know it is done?
Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?
Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Customize this flavorful One-Pot Lemon Herb Pesto Cannellini Beans and Spinach to suit different dietary preferences or ingredient availability with these simple swaps:

  • Cannellini Beans: Substitute chickpeas or navy beans for a varied texture while keeping protein content high.
  • Fresh Baby Spinach: Use kale, Swiss chard, or arugula for heartier or peppery green alternatives.
  • Vegetable Broth: Try low-sodium chicken broth (if not vegetarian) or mushroom broth for added umami depth.
  • Basil Pesto:
  • Lemon Zest and Juice: Lime zest and juice can provide a bright alternative citrus twist.
  • Olive Oil: Replace with avocado oil or light vegetable oil if preferred.
  • Toasted Pine Nuts: Swap with toasted walnuts, almonds, or pumpkin seeds for budget-friendly or allergy-conscious garnishes.

These ingredient substitutions maintain the recipe’s quick, healthy, and family-friendly qualities while preserving the comforting Italian-inspired flavors essential to your one-pot collection.

Storage and Reheating

Cool One-Pot Lemon Herb Pesto Cannellini Beans and Spinach before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.