PanPotPlates

One-Pot Comfort Food

One-Pot Lemon Herb Pesto Cannellini Beans and Spinach

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished May 11, 2026
Italian-Inspired 25 mins onepotvegetarianhealthyfamily-friendlyquickeasycomfortfoodglutenfreedairyfree

Enjoy a quick, healthy, and comforting one-pot meal featuring tender cannellini beans, fresh spinach, and vibrant lemon herb pesto for a flavorful Italian-inspired dinner.

One-Pot Lemon Herb Pesto Cannellini Beans and Spinach
Prep 10 min
Cook 15 min
Total 25 min
Servings 4
Difficulty easy
Cuisine Italian-Inspired

Recipe Details

Prep10 min
Cook15 min
Total25 min
Servings4
Difficultyeasy
CuisineItalian-Inspired
Add To Favorites

Ingredients

Servings 4
  • 2 tablespoons olive oil
  • 1 small yellow onion, finely chopped
  • 3 cloves garlic, minced
  • 1 (15-ounce) can cannellini beans, drained and rinsed
  • 4 cups fresh baby spinach
  • 1 cup vegetable broth
  • 1 tablespoon lemon zest
  • 2 tablespoons fresh lemon juice
  • 1/4 cup prepared basil pesto (store-bought or homemade, dairy-free if preferred)
  • Salt and freshly ground black pepper, to taste
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • Fresh basil leaves, for garnish
  • Toasted pine nuts, for garnish (optional)

Instructions

  1. Heat the olive oil in a large deep skillet or sauté pan over medium heat.
  2. Add the finely chopped onion and sauté for 3-4 minutes until soft and translucent.
  3. Stir in the minced garlic and cook for 30 seconds until fragrant, being careful not to burn it.
  4. Add the cannellini beans to the pan and pour in the vegetable broth. Stir to combine.
  5. Bring the mixture to a light simmer and cook for 5 minutes to allow flavors to meld.
  6. Add the fresh baby spinach, stirring until wilted and incorporated.
  7. Remove the pan from heat and stir in the lemon zest, lemon juice, and basil pesto until well coated.
  8. Season with salt, freshly ground black pepper, and crushed red pepper flakes (if using) to taste.
  9. Serve immediately, garnished with fresh basil leaves and toasted pine nuts for extra texture and flavor.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Customize this flavorful One-Pot Lemon Herb Pesto Cannellini Beans and Spinach to suit different dietary preferences or ingredient availability with these simple swaps:

  • Cannellini Beans: Substitute chickpeas or navy beans for a varied texture while keeping protein content high.
  • Fresh Baby Spinach: Use kale, Swiss chard, or arugula for heartier or peppery green alternatives.
  • Vegetable Broth: Try low-sodium chicken broth (if not vegetarian) or mushroom broth for added umami depth.
  • Basil Pesto: Select pesto made with nutritional yeast instead of cheese to ensure vegan and dairyfree options; many store-bought vegan pestos are also suitable.
  • Lemon Zest and Juice: Lime zest and juice can provide a bright alternative citrus twist.
  • Olive Oil: Replace with avocado oil or light vegetable oil if preferred.
  • Toasted Pine Nuts: Swap with toasted walnuts, almonds, or pumpkin seeds for budget-friendly or allergy-conscious garnishes.

These ingredient substitutions maintain the recipe’s quick, healthy, and family-friendly qualities while preserving the comforting Italian-inspired flavors essential to your one-pot collection.

Pan Or Pot Required

This recipe is crafted as a comforting One-Pot Comfort Food meal, focusing on simplicity and minimal cleanup by using a single cooking vessel. For the One-Pot Lemon Herb Pesto Cannellini Beans and Spinach, a large deep skillet or sauté pan with a lid is essential.

The deep skillet offers ample space to sauté aromatics, simmer cannellini beans in vegetable broth, and wilt fresh spinach all in one pan, allowing flavors to blend harmoniously without transferring between dishes. Its depth also contains the simmering liquids effectively and prevents spills during stirring.

Opting for a heavy-bottomed skillet or sauté pan ensures even heat distribution, which is beneficial for gently cooking onions and simmering the broth without burning ingredients.

This cookware choice perfectly aligns with the quick, easy, healthy, family-friendly, vegetarian, glutenfree, and dairyfree tags of the recipe, supporting a seamless one-pot cooking experience with minimal cleanup—ideal for busy weeknight dinners and convenient meal prep.

Cookware Size Guidance

For this One-Pot Comfort Food recipe serving 4 people, use a large deep skillet or sauté pan with a capacity of about 3 to 4 quarts. This size provides enough room to comfortably sauté onions and garlic, simmer the cannellini beans and broth without overcrowding, and incorporate fresh spinach with ease.

A skillet with at least a 10-inch diameter is ideal to ensure ample surface area for even cooking and stirring, which promotes proper flavor melding during simmering.

Using cookware that is too small can lead to overcrowding and uneven cooking, while excessively large pans may cause liquids to evaporate too quickly. A medium-large deep skillet or sauté pan strikes the best balance for achieving a quick, healthy, and flavorful one-pot meal.

Cookware Swap Guidance

This recipe is designed as a One-Pot Comfort Food dish and is best prepared in a large deep skillet or sauté pan to allow sufficient space for stirring and even heat distribution when cooking cannellini beans and spinach. If you don't have a deep skillet or sauté pan, consider these suitable cookware swaps that fit the PanPotPlates approach:

  • Deep Nonstick Frying Pan: A heavy-bottomed nonstick frying pan with a lid is excellent for sautéing aromatics and simmering beans and greens with minimal sticking.
  • Medium Dutch Oven or Casserole Pot: These offer great heat retention and depth, making them excellent alternatives for simmering and avoiding multiple dishes, while maintaining the recipe's quick, healthy, and easy nature.
  • Wide-Bottomed Saucepan: If deeper than a skillet, a saucepan can handle sautéing and simmering effectively; just note that a smaller surface area may slightly affect liquid evaporation rates.

Avoid using flat sheet pans or shallow griddles, as they do not retain liquids or support simmering needed for melded flavors. This recipe is also not optimized for slow cooker or Instant Pot formats without adaptation, since the fresh spinach is best wilted briefly on the stovetop and the pesto stirred in off heat to preserve its brightness and texture.

Choosing the right cookware replacement ensures your meal stays family-friendly, quick, and easy to prepare, without compromising the fresh, vibrant flavors or glutenfree and dairyfree qualities. Perfect for a healthy weeknight one-pot dinner that minimizes cleanup while maximizing taste.

Leftovers Quality

This one-pot lemon herb pesto cannellini beans and spinach dish stores well as leftovers, making it an excellent option for meal prep and family-friendly weeknight dinners. Keep any uneaten portions in an airtight container in the refrigerator for up to 3–4 days. Flavors continue to meld during storage, enhancing the bright lemon and fresh pesto notes.

When reheating, warm gently in a skillet over medium-low heat, stirring occasionally to maintain bean texture and prevent the spinach from becoming too wilted. Alternatively, microwave covered, stirring halfway through for even heating. Adding a splash of vegetable broth or a drizzle of olive oil can help revive the sauce if it appears dry.

Since this dish is naturally glutenfree and dairyfree, leftovers remain healthy and satisfying. Freezing is also possible—portion into freezer-safe containers and freeze for up to 1 month. Thaw overnight in the refrigerator and reheat as directed. This makes a quick, easy, and flavorful freezer meal perfect for your Italian-inspired comfort food rotation.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.