What cookware works best?

Use a wide skillet and avoid crowding so the recipe cooks evenly.

How do I know it is done?

Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.

Can I adjust the seasoning?

Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Back to Recipes

Skillet Meals

Skillet Mediterranean Chickpea and Spinach Sauté

Name: Skillet Mediterranean Chickpea and Spinach Sauté
Prep time: 7 min
Cook time: 13 min
Total time: 20 min
Yield: 4 servings
Cuisine: Mediterranean-Inspired
Ingredients: 2 tablespoons extra virgin olive oil; 1 medium yellow onion, diced; 3 garlic cloves, minced; 1 red bell pepper, diced; 1 (15-ounce) can chickpeas, drained and rinsed; 5 cups fresh baby spinach; 1 teaspoon ground cumin; 1 teaspoon smoked paprika; 1/2 teaspoon ground coriander; 1/4 teaspoon crushed red pepper flakes (optional); Salt and freshly ground black pepper, to taste; 1 tablespoon fresh lemon juice; 2 tablespoons chopped fresh parsley; 1/4 cup crumbled vegan feta cheese (optional, for garnish)

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 22, 2026 · Updated May 12, 2026

Mediterranean-Inspired 20 mins onepanskilleteasyquickhealthyveganfamily-friendlyglutenfreedairyfreebudget-friendlyweeknight

A vibrant and healthy one-pan Mediterranean-inspired chickpea and spinach sauté that's quick, easy, and perfect for weeknight family dinners. Packed with protein, fiber, and fresh Mediterranean flavors, this vegan and gluten-free skillet meal comes together in just 20 minutes using simple, budget-friendly ingredients.

Skillet Mediterranean Chickpea and Spinach Sauté

Prep 7 min

Cook 13 min

Total 20 min

Servings 4

Difficulty easy

Cuisine Mediterranean-Inspired

Ingredients

Servings 4

2 tablespoons extra virgin olive oil
1 medium yellow onion, diced
3 garlic cloves, minced
1 red bell pepper, diced
1 (15-ounce) can chickpeas, drained and rinsed
5 cups fresh baby spinach
1 teaspoon ground cumin
1 teaspoon smoked paprika
1/2 teaspoon ground coriander
1/4 teaspoon crushed red pepper flakes (optional)
Salt and freshly ground black pepper, to taste
1 tablespoon fresh lemon juice
2 tablespoons chopped fresh parsley
1/4 cup crumbled vegan feta cheese (optional, for garnish)

Ingredients for Skillet Mediterranean Chickpea and Spinach Sauté

Instructions

Heat the olive oil in a large 10 to 12-inch skillet over medium heat.
Add the diced onion and sauté for 3-4 minutes until translucent and fragrant.
Stir in the minced garlic and diced red bell pepper; cook for another 3 minutes until the pepper softens slightly.
Add the drained chickpeas to the skillet along with ground cumin, smoked paprika, ground coriander, crushed red pepper flakes (if using), salt, and black pepper.
Cook for 5 minutes, stirring occasionally, allowing the spices to toast and the chickpeas to heat through.
Gradually add the fresh baby spinach by handfuls, stirring until wilted before adding more.
Once all the spinach is incorporated and wilted, remove the skillet from heat.
Stir in fresh lemon juice and chopped parsley to brighten the flavors.
Taste and adjust seasoning with additional salt and pepper as needed.
Serve immediately, garnished with crumbled vegan feta if desired. This dish pairs well with warm crusty gluten-free bread or a simple side of quinoa for a complete Mediterranean-inspired meal.

Skillet Mediterranean Chickpea and Spinach Sauté cooking in the recommended pan or pot

Tips

Pan Or Pot Required

This recipe is designed for a large 10 to 12-inch skillet , essential for cooking the Mediterranean Chickpea and Spinach Sauté evenly and efficiently.

Cookware Size Guidance

For the Skillet Mediterranean Chickpea and Spinach Sauté , a 10 to 12-inch (25 to 30 cm) skillet is optimal.

Cookware Swap Guidance

This recipe is built around using a large skillet for quick, even cooking of onions, garlic, bell pepper, chickpeas, and gently wilting fresh spinach.

Leftovers Quality

Reheat gently and add a splash of liquid when needed to keep the texture moist and tender.

Frequently Asked Questions

Can I make Skillet Mediterranean Chickpea and Spinach Sauté ahead?: Yes. Prep the ingredients or cook the full dish ahead, then reheat gently so the texture stays close to freshly made.
What cookware works best?: Use a wide skillet and avoid crowding so the recipe cooks evenly.
How do I know it is done?: Follow the recipe timing, then check the main ingredient for tenderness, bubbling, browning, or safe doneness before serving.
Can I adjust the seasoning?: Yes. Taste near the end and adjust salt, acid, herbs, or heat in small amounts.

Ingredient Replacements and Substitutions

This Mediterranean-inspired recipe is highly adaptable, allowing easy swaps to suit dietary needs, ingredient availability, or flavor preferences without compromising taste or nutrition.

Chickpeas: Substitute with cooked white beans, lentils, or canned cannellini beans to vary protein sources while keeping the dish hearty and vegan.
Spinach: Replace with kale, Swiss chard, or collard greens for a heartier texture; increase sauté time to soften tougher greens.
Red Bell Pepper: Use yellow or orange bell peppers for added sweetness, or swap with diced zucchini for a different texture and moisture.
Vegan Feta Cheese (optional): Omit or substitute with crumbled firm tofu marinated in lemon and herbs for a dairy-free tangy kick and extra protein.
Olive Oil: Substitute with avocado or grapeseed oil for a neutral oil with a higher smoke point while retaining health benefits.
Spices (Cumin, Smoked Paprika, Ground Coriander): Adjust quantities to taste or swap smoked paprika with regular paprika for less smokiness.
Lemon Juice: Use lime juice or a splash of apple cider or red wine vinegar for bright, fresh acidity.

These substitutions maintain the recipe’s quick, healthy, vegan, family-friendly, gluten-free, and budget-friendly qualities while offering flavorful customization perfect for your kitchen and palate.

Storage and Reheating

Cool Skillet Mediterranean Chickpea and Spinach Sauté before storing. Refrigerate leftovers in an airtight container for up to 4 days.

Freeze portions for longer storage when the ingredients are freezer-friendly. Reheat gently with a splash of liquid if the dish looks dry.

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Skillet Mediterranean Chickpea and Spinach Sauté

Recipe Details

Ingredients

Instructions