PanPotPlates

Skillet Meals

Skillet Mediterranean Chickpea and Spinach Sauté

By PanPotPlates Test KitchenReviewed by PanPotPlates Editorial TeamPublished Apr 22, 2026 · Updated May 12, 2026
Mediterranean-Inspired 20 mins onepanskilleteasyquickhealthyveganfamily-friendlyglutenfreedairyfreebudget-friendlyweeknight

A vibrant and healthy one-pan Mediterranean-inspired chickpea and spinach sauté that's quick, easy, and perfect for weeknight family dinners. Packed with protein, fiber, and fresh Mediterranean flavors, this vegan and gluten-free skillet meal comes together in just 20 minutes using simple, budget-friendly ingredients.

Skillet Mediterranean Chickpea and Spinach Sauté
Prep 7 min
Cook 13 min
Total 20 min
Servings 4
Difficulty easy
Cuisine Mediterranean-Inspired

Recipe Details

Prep7 min
Cook13 min
Total20 min
Servings4
Difficultyeasy
CuisineMediterranean-Inspired
Add To Favorites

Ingredients

Servings 4
  • 2 tablespoons extra virgin olive oil
  • 1 medium yellow onion, diced
  • 3 garlic cloves, minced
  • 1 red bell pepper, diced
  • 1 (15-ounce) can chickpeas, drained and rinsed
  • 5 cups fresh baby spinach
  • 1 teaspoon ground cumin
  • 1 teaspoon smoked paprika
  • 1/2 teaspoon ground coriander
  • 1/4 teaspoon crushed red pepper flakes (optional)
  • Salt and freshly ground black pepper, to taste
  • 1 tablespoon fresh lemon juice
  • 2 tablespoons chopped fresh parsley
  • 1/4 cup crumbled vegan feta cheese (optional, for garnish)

Instructions

  1. Heat the olive oil in a large 10 to 12-inch skillet over medium heat.
  2. Add the diced onion and sauté for 3-4 minutes until translucent and fragrant.
  3. Stir in the minced garlic and diced red bell pepper; cook for another 3 minutes until the pepper softens slightly.
  4. Add the drained chickpeas to the skillet along with ground cumin, smoked paprika, ground coriander, crushed red pepper flakes (if using), salt, and black pepper.
  5. Cook for 5 minutes, stirring occasionally, allowing the spices to toast and the chickpeas to heat through.
  6. Gradually add the fresh baby spinach by handfuls, stirring until wilted before adding more.
  7. Once all the spinach is incorporated and wilted, remove the skillet from heat.
  8. Stir in fresh lemon juice and chopped parsley to brighten the flavors.
  9. Taste and adjust seasoning with additional salt and pepper as needed.
  10. Serve immediately, garnished with crumbled vegan feta if desired. This dish pairs well with warm crusty gluten-free bread or a simple side of quinoa for a complete Mediterranean-inspired meal.

Frequently Asked Questions

Reader questions and answers for this recipe will appear here.

Ingredient Replacements and Substitutions

This Mediterranean-inspired recipe is highly adaptable, allowing easy swaps to suit dietary needs, ingredient availability, or flavor preferences without compromising taste or nutrition.

  • Chickpeas: Substitute with cooked white beans, lentils, or canned cannellini beans to vary protein sources while keeping the dish hearty and vegan.
  • Spinach: Replace with kale, Swiss chard, or collard greens for a heartier texture; increase sauté time to soften tougher greens.
  • Red Bell Pepper: Use yellow or orange bell peppers for added sweetness, or swap with diced zucchini for a different texture and moisture.
  • Vegan Feta Cheese (optional): Omit or substitute with crumbled firm tofu marinated in lemon and herbs for a dairy-free tangy kick and extra protein.
  • Olive Oil: Substitute with avocado or grapeseed oil for a neutral oil with a higher smoke point while retaining health benefits.
  • Spices (Cumin, Smoked Paprika, Ground Coriander): Adjust quantities to taste or swap smoked paprika with regular paprika for less smokiness.
  • Lemon Juice: Use lime juice or a splash of apple cider or red wine vinegar for bright, fresh acidity.

These substitutions maintain the recipe’s quick, healthy, vegan, family-friendly, gluten-free, and budget-friendly qualities while offering flavorful customization perfect for your kitchen and palate.

Pan Or Pot Required

This recipe is designed for a large 10 to 12-inch skillet, essential for cooking the Mediterranean Chickpea and Spinach Sauté evenly and efficiently. The skillet provides enough surface area to sauté the vegetables and chickpeas without overcrowding, ensuring optimal texture and authentic Mediterranean flavors.

A heavy-bottomed skillet with a non-stick coating or stainless steel surface is recommended to prevent sticking and facilitate easy stirring. Since this is a quick one-pan meal, using a skillet aligns perfectly with our focus on easy, quick, healthy, and family-friendly meals that maximize flavor while minimizing cleanup.

Using a properly sized skillet ensures even cooking and a vibrant, fresh finish that’s perfect for busy weeknights or budget-friendly Mediterranean dining.

Cookware Size Guidance

For the Skillet Mediterranean Chickpea and Spinach Sauté, a 10 to 12-inch (25 to 30 cm) skillet is optimal. This size offers ample room to evenly cook onions, bell peppers, and chickpeas while making it easy to gradually wilt the fresh spinach without overcrowding. Choose a skillet with a heavy bottom to ensure even heat distribution and to prevent sticking.

This skillet size comfortably serves 4 and is perfect for quick, family-friendly weeknight dinners that are both healthy and budget-conscious.

Cookware Swap Guidance

This recipe is built around using a large skillet for quick, even cooking of onions, garlic, bell pepper, chickpeas, and gently wilting fresh spinach. If you don’t have a skillet, here are recommended cookware alternatives that maintain the recipe’s one-pan, quick, and family-friendly nature:

  • Sauté Pan: With higher sides than a skillet, a sauté pan helps contain ingredients while providing excellent heat distribution for even cooking and easy stirring.
  • Cast Iron Pan: Offers excellent heat retention and can add natural caramelization to the vegetables. Use medium heat to avoid burning.
  • Nonstick Frying Pan: Facilitates easy cleanup and helps cook with less oil, preserving the healthy, vegan, and budget-friendly profile.
  • Deep Skillet or Sauté Pan: If your current skillet is small, a deeper pan helps accommodate ingredient volume and makes stirring the spinach easier.

Avoid using stockpots, large saucepans, slow cookers, Instant Pots, or baking dishes as they do not provide the proper cooking surface or heat distribution needed for this Mediterranean sauté. Sticking to skillet and pan options keeps the dish quick, easy, and flavorful—ideal for busy weeknight family dinners.

Leftovers Quality

This Skillet Mediterranean Chickpea and Spinach Sauté makes excellent leftovers, perfect for meal prep or quick family meals later in the week. When stored properly in an airtight container, leftovers remain flavorful with a good texture for up to 3-4 days refrigerated.

Due to the fresh spinach and lemon juice, consume leftovers within this timeframe to avoid sogginess or flavor loss.

Reheat gently in a skillet over medium heat, stirring occasionally to preserve chickpea texture and prevent overcooking the spinach. Alternatively, microwave covered in 1-minute intervals, stirring between intervals for even heating.

Limit reheating to once to maintain food safety and quality. To freeze leftovers, omit fresh lemon juice and parsley before freezing; add these fresh after thawing and reheating to keep their bright Mediterranean flavors fresh. Serve leftovers warmed with quinoa or gluten-free bread for a nourishing and satisfying meal.

Related Articles

Read related air fryer guides and cooking tips.

More Recipes

Explore more recipes you may like.

Reviews

Rate this recipe and share a photo of your result.

No reviews yet.

Newsletter

Stay In The Loop

Get fresh recipes, articles, and updates from PanPotPlates.